KEGG   Escherichia coli BL21(DE3): B21_04089Help
Entry
B21_04089         CDS       T02096                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III, chi subunit, subunit of DNA polymerase III, preinitiation complex and DNA polymerase III, holoenzyme
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
ebe00230  Purine metabolism
ebe00240  Pyrimidine metabolism
ebe01100  Metabolic pathways
ebe03030  DNA replication
ebe03430  Mismatch repair
ebe03440  Homologous recombination
Module
ebe_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    B21_04089 (holC)
   00240 Pyrimidine metabolism
    B21_04089 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    B21_04089 (holC)
   03430 Mismatch repair
    B21_04089 (holC)
   03440 Homologous recombination
    B21_04089 (holC)
Enzymes [BR:ebe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     B21_04089 (holC)
DNA replication proteins [BR:ebe03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     B21_04089 (holC)
DNA repair and recombination proteins [BR:ebe03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     B21_04089 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: CAQ34606
UniProt: A0A140NEC1
Structure
PDB: 

Jmol
Position
complement(4395229..4395672)
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTTIDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRSSSPRDILISLRTSFADFATAFTEVVDFVPYE
DSLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcaacgttctaccttctggacaatgacaccaccatcgatggcttaagcgcc
gttgagcagctggtgtgtgaaattgccgcagaacgttggcgcagcggtaagcgcgtgctc
atcgcctgtgaagatgaaaagcaggcttaccggctggatgaagccctgtgggcgcgtccg
gcagaaagctttgttccgcataatttagcgggagaaggaccgcgcggcggtgcgccggtg
gagatcgcctggccgcaaaaacgcagcagcagcccgcgcgatatattgattagtctgcga
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgttccttatgaa
gattctctgaaacaactggcgcgcgaacgctataaagcctaccgcgtggctggtttcaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system