KEGG   Escherichia coli BL21(DE3): B21_04089Help
Entry
B21_04089         CDS       T02096                                 

Gene name
holC
Definition
DNA polymerase III, chi subunit, subunit of DNA polymerase III, preinitiation complex and DNA polymerase III, holoenzyme
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    B21_04089 (holC)
   00240 Pyrimidine metabolism
    B21_04089 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    B21_04089 (holC)
   03430 Mismatch repair
    B21_04089 (holC)
   03440 Homologous recombination
    B21_04089 (holC)
Enzymes [BR:ebe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     B21_04089 (holC)
DNA replication proteins [BR:ebe03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     B21_04089 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4395229..4395672)
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTTIDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRSSSPRDILISLRTSFADFATAFTEVVDFVPYE
DSLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcaacgttctaccttctggacaatgacaccaccatcgatggcttaagcgcc
gttgagcagctggtgtgtgaaattgccgcagaacgttggcgcagcggtaagcgcgtgctc
atcgcctgtgaagatgaaaagcaggcttaccggctggatgaagccctgtgggcgcgtccg
gcagaaagctttgttccgcataatttagcgggagaaggaccgcgcggcggtgcgccggtg
gagatcgcctggccgcaaaaacgcagcagcagcccgcgcgatatattgattagtctgcga
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgttccttatgaa
gattctctgaaacaactggcgcgcgaacgctataaagcctaccgcgtggctggtttcaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system