KEGG   Escherichia coli BL21(DE3): B21_04213Help
Entry
B21_04213         CDS       T02096                                 

Gene name
holD
Definition
DNA polymerase III, psi subunit, subunit of DNA polymerase III, preinitiation complex and DNA polymerase III, holoenzyme
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ebe00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ebe00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ebe03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ebe03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ebe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4526172..4526585
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSHCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggagattgccattgcgatcccggcacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgactgatcctttagtgagcgatgttctgcgcgca
ttaaccgtcagccccgaccaggtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcactgcaacagttggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgatttacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system