KEGG   Enterobacteriaceae bacterium FGI 57: D782_0061Help
Entry
D782_0061         CDS       T02431                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    D782_0061
Enzymes [BR:ebf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     D782_0061
Exosome [BR:ebf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D782_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(70695..72203)
Genome map
AA seq 502 aa AA seqDB search
MTDKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSST
LVEVLAKADINSDQIAAIGITNQRETTVVWERETGKPIYNAIVWQCRRTADICEQLKRDG
MEEYVRKATGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNINELDWDDKMLEALDIPRAMLPEVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSEHGLLTTIACGPRGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRALAWEDHGE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaaaaaatatatcgttgcgctcgaccagggcactaccagttcccgcgccgtg
gtgatggatcacgatgccaatatcatcagtgtttcacagcgcgagtttgaacaaatttat
ccgaagccaggctgggttgagcacgacccgatggaaatctgggcaacccagagctccacg
ctggtcgaagtgctggcaaaagccgatatcaattccgatcagattgccgcgattggtatc
accaaccagcgcgaaaccaccgtggtgtgggaacgcgaaaccgggaaaccgatttataac
gcgattgtctggcagtgccgccgtaccgccgacatctgcgaacagctgaaacgcgacggc
atggaagagtatgtgcgcaaagccaccggtctggtggtcgacccgtacttctccggcacc
aaagtgaaatggatcctcgaccacgttgagggctcccgtgaacgcgcgaagcgtggcgaa
ctgctgttcggtaccgtcgacacctggcttatctggaaaatgacccaggggcgcgtgcac
gtcaccgactacaccaacgcctcacgtaccatgctgttcaacatcaacgagctggactgg
gatgacaaaatgctcgaagcgctcgacatcccgcgcgccatgctgccagaagtacgcaaa
tcctcggaagtgtatggtcagaccaacatcggcgggaaaggcggtacgcgtattccgatc
gccgggatcgcaggcgatcagcaggcggcgctgttcggccagctgtgcgtgaaggaaggg
atggcgaaaaacacctacggcaccggctgctttatgctgatgaacaccggcgaaaaagcg
gtgaaatccgagcatggtctgctgaccaccattgcctgcggcccacgcggcgaagtgaac
tatgcgctggaaggcgcggtgtttatggccggcgcctctattcagtggctgcgcgatgag
atgaaactcatcagcgacgcattcgactctgagtattttgcgaccaaagtaaaagatacc
aatggggtgtatgtggttccggcgtttaccggcctcggcgcaccgtactgggacccgtat
gcgcgcggcgcgattttcggcctgacgcgcggcgtcaactcgaaccacattattcgcgcc
acgctggaatccatcgcctatcaaacgcgcgacgtgctggaagcgatgcaggctgactcc
ggcattcgtctgcacgccctgcgcgtggacggcggcgcggttgccaataatttcctgatg
cagttccagtcagacattctgggtacccgcgtagagcgcccggaagtgcgtgaagtcact
gcgttaggtgctgcgtatctcgcgggcctggcggtaggcttctggcaaaatctggatgaa
ttgcaggagaaagcggtgattgagcgtgaattccgcccgggaatcgaaacgaccgagcgt
aattatcgttacagcggctggaaaaaagcggtgaaacgcgcgctggcgtgggaagatcac
ggagagtaa

DBGET integrated database retrieval system