KEGG   Enterobacteriaceae bacterium FGI 57: D782_0162Help
Entry
D782_0162         CDS       T02431                                 

Definition
D-xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ebf00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ebf00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
172272..173594
Genome map
AA seq 440 aa AA seqDB search
MQAYFDQLDRVRFEGPKTENPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGAFDRPWQQPGEAIALAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYLNNFA
QMVDVLAEKQQQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVFTAMNATHKL
GGENYVLWGGREGYESLLNTDLRQEREQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDASTVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DPQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKVAARMIEGGELDKRVAKRYAGWNGELGQQILKGQMSLQDLAKYAEQHQLAPQ
HQSGHQELLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcttatttcgaccaactggatcgtgttcgtttcgaaggcccgaaaacggaaaac
ccactggctttccgccactacaaccctgacgaactggtgctgggtaaacggatggaagat
cacctgcgcttcgccgcctgctactggcacaccttctgctggaatggcgcagatatgttc
ggcgtgggcgcatttgaccgcccgtggcagcaaccgggcgaagccattgccctggcgaaa
cgcaaagctgatgtcgcatttgaattcttccataagctgaacgtgccttactactgcttc
catgatgttgacgtatcgccggaaggcgcgtcgctgaaagagtatctgaacaacttcgcg
caaatggtagacgtgctggctgaaaaacagcagcagagcggcgtgaagctgctgtggggc
accgccaactgctttactaacccgcgctacggcgcaggcgcggcaacgaaccctgacccg
gaagtctttagctgggcggcgactcaggtcttcaccgcgatgaatgccactcacaaactg
ggcggcgagaactacgtgctgtgggggggccgcgaaggctatgaatccctgttgaatacc
gacctgcgtcaggaacgcgagcagattggccgcttcatgcagatggtggtagagcacaaa
cataaaatcggtttccagggcactctgcttatcgaaccgaaaccgcaggaaccgaccaag
catcaatatgattacgatgcatcgaccgtttatggcttccttaaacagttcggcctggaa
aaagagattaaactgaacatcgaagcaaaccacgcgacgctggcagggcactctttccac
cacgaaattgctaccgcaattgcgttgggcctgttcggttccgtcgatgctaaccgtggc
gatccgcagttgggctgggataccgaccagttcccgaacagcgtggaagagaacgcgctg
gtgatgtacgaaatcctcaaagcgggcggcttcactaccggtggcctgaacttcgatgcg
aaagtgcgtcgtcagagtaccgacaaatatgacctgttctatggccacattggcgcgatg
gacaccatggcactgtcgctgaaagtggcggcgcgtatgattgaaggcggcgagctggat
aaacgtgtggctaagcgttacgcgggctggaacggtgaactgggtcagcaaatcctgaaa
gggcagatgtcgctgcaggacctggcaaaatatgccgagcagcatcagctggcgccgcag
catcagagcggtcaccaggagctgctggaaaacctggtcaatcactacctgttcgacaaa
taa

DBGET integrated database retrieval system