KEGG   Enterobacteriaceae bacterium FGI 57: D782_0205Help
Entry
D782_0205         CDS       T02431                                 

Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ebf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
215964..217070
Genome map
AA seq 368 aa AA seqDB search
MKSVRWIVLLLALGTMVQAQAACNWPAWDQFKKDYVSAEGRVIDPSDARKITTSEGQSYA
LFFALAANDRETFGKLFDWTQNNLAQGDLKSTLPAWLWGKKDDNAWTVLDTNSASDSDVW
IAWSLLEAGRLWKNANYTETGKALLSRIAREEVVNVPGLGSMLLPGKIGFAEANSWRFNP
SYLPPQLASYFTRFGAPWTTLRETNQRLLMETAPKGYSPDWVNYEKGKGWQKQSKTPLVG
SYDAIRVYLWVGMMHNSDPQKARLLTRFNAMAAQTAREGVPPEKVDTLTGKVTGNGPVGF
SASLLPFLQDRDAQAVQRQRVADNFPGADAYYSYVLTLFGQGWDQHRFRFSARGELLPDW
GQECASSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgtacgctggatagttttgctgttagcgctgggcacgatggtacaggcccag
gcggcctgtaactggcctgcctgggatcagttcaaaaaagactatgtcagtgccgaaggg
cgcgtgatcgacccgagcgatgcacgcaaaattaccacctccgaagggcagagctatgcg
ctgttcttcgcgctggcggctaacgaccgcgaaacgttcggtaaactgttcgactggacg
cagaacaacctggcgcagggtgacctgaaaagcacgctgcctgcctggctgtggggcaag
aaagacgacaacgcctggacggtgctggataccaactccgcatccgattctgacgtctgg
attgcctggtcgctgctggaagcgggtcgcctgtggaagaacgcgaactataccgaaaca
gggaaagcgctgctctcgcgcattgcccgggaagaggtggtcaacgtgccggggttaggc
tcaatgctgttgccgggcaaaattggttttgccgaagccaatagctggcgcttcaaccca
agctacctgccgccgcagctggcgagctacttcacccgctttggggcaccgtggacgacg
ctgcgcgaaaccaaccagcgcctgctgatggaaaccgccccgaaaggctattcgccggac
tgggtgaactatgagaaaggcaagggctggcagaagcagagtaaaacgccgctggtgggc
agctatgacgccatccgcgtctatttgtgggtgggcatgatgcacaacagcgacccgcaa
aaagcccgtctgttaacccgatttaacgcgatggcggcgcagaccgcccgcgaaggcgtt
ccgccggaaaaagtcgacaccctcaccggcaaagtcaccggcaatggcccggtgggcttc
tccgcctcgctgctgccgttcctgcaggaccgcgatgcgcaggccgttcagcgccagcgc
gtagccgacaacttccctggcgcagacgcctattacagctatgtcctgaccctctttggc
cagggctgggaccaacaccgttttcgcttcagcgcccgcggtgaattactacctgactgg
ggccaggaatgcgcaagttcacactaa

DBGET integrated database retrieval system