KEGG   Enterobacteriaceae bacterium FGI 57: D782_0285Help
Entry
D782_0285         CDS       T02431                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D782_0285
Enzymes [BR:ebf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     D782_0285
Exosome [BR:ebf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D782_0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
305759..307945
Genome map
AA seq 728 aa AA seqDB search
MSDRIDRDVINALIAGHFADPFSVLGMHSTEAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDSRGFFCGVLPRRKNPFRYQLAVVWHGQQNLIDDPYRFGPLLQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRGETGIWELFVP
GAHNGQLYKFEMIDAHGKLRIKADPYAFEAQMRPETASLICGLPEKVVQTEERKKANGFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTREDFRYFINAAHAAGLNVILDWVPGHFPSDDFALAEFDGTKLYEHD
DPREGYHQDWNTLIYNYGRREVSNYLTGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRTTNRVLGEQVPGAVSMAEESTDFAGVSRPQDMGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKMTFGLLYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWLFAFPGKKLLFMGNEFAQGREWNHDGSLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDPYGFEWLVVDDHERSVFIFVRRDKQGNELIVASNFTPV
PRHDYRFGINQPGSWREELNTDSAHYHGSNAGNGGVVHSDHIASHGREHSLSLTLPPLST
IWLVREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcgtattgatagagacgtgattaacgcgctaattgctggccattttgcggat
cctttttccgttctggggatgcatagcaccgaagcagggctggaagtccgggcgctttta
cctgatgcgactgatgtctgggttatcgaaccgaaaaccgggcgtaaagtcggtaagctc
gagtgtttagactcgcgcggtttcttttgcggcgttctgccgcgacgtaaaaaccctttt
cgttatcaactggcggtggtttggcacggtcagcagaatctgatcgacgacccctatcgc
ttcggcccgctgttgcaggagatggacgcatggctgctgtctgaaggcacgcacctgcgc
ccgtacgaaacgctgggcgcgcatgccgacacaatggacggcgtgaccggcacgcgcttc
tctgtgtgggcacccaacgcccgccgcgtctcggtggtcgggcagttcaactactgggat
ggccgtcgccatccgatgcgcctgcgcggtgaaacggggatctgggaactgtttgtgccc
ggcgcgcataacggtcagctctataaatttgagatgatcgacgcgcacggcaaactgcgc
atcaaagccgacccttacgccttcgaagcccagatgcgaccagaaacggcctcgctgatt
tgcggcctgccggaaaaagtggtgcagacggaagagcgtaaaaaagcgaatggctttgac
gcgccgatttccatctatgaagtgcatctcggttcctggcgtcgccatacggataacaat
ttctggctgagctatcgcgagctggcggaccagttagtgccgtacgcgaaatggatgggc
tttacccatctggagctgctgccggttaacgagcatccgttcgacggtagctggggctac
cagccaaccgggctgtacgcgccgacgcgccgtttcggtacgcgcgaagatttccgctac
tttatcaatgccgcgcatgcggccgggctgaacgtgattctcgactgggtgccgggccac
ttcccgtcggatgacttcgcgctggcggaattcgacggcaccaaactctacgaacatgat
gacccgcgtgaaggctaccatcaggactggaataccctgatttacaactatggccgccgt
gaagtcagtaactatctgacgggcaatgcgctgtactggatcgaacgctttggcatcgat
gcgctgcgcgtggatgcggtggcttccatgatctaccgcgactacagccgtaaagaaggt
gagtggatccccaatgaatttggcggccgcgaaaacctggaagcgattgaatttctgcgc
acaaccaaccgcgtgctgggcgagcaggttcccggtgcggtgagtatggcggaagagtcg
accgattttgccggcgtttctcgcccgcaggatatgggcggcctggggttctggtacaag
tggaatctgggctggatgcacgacacgctcgactacatgaagcttgacccggtatatcgt
cagtatcatcacgacaaaatgaccttcgggctgctttacaactacacggaaaacttcgtg
ctgccgctgtcgcacgatgaagtggtccacggtaagaaatcgattctcgaccgtatgccg
ggggatgcgtggcagaaatttgccaacctgcgcgcctactacggctggctgtttgcgttc
cccggcaaaaagctgctgttcatgggcaacgaatttgcgcaggggcgtgagtggaaccac
gacggcagtctcgactggcatctgctggaaggcggcgacaactggcaccacggcgttcag
cgtctggtgcgtgacctgaaccacacctatcgtcaccataaagcgctgcacgagctcgac
tttgacccgtacggctttgagtggctggtggttgatgaccatgaacgttcggtctttatc
tttgtgcgtcgcgacaagcagggcaatgaactgatcgtcgccagcaactttacgccggtg
ccgcgccacgattaccgcttcggtattaatcagccgggtagctggcgtgaagagctgaac
actgactccgcacactatcacggcagcaatgccgggaacggcggcgtggtgcacagcgac
cacatcgccagccacgggcgtgagcactctctgagcctgacgttgccgccgctgtccacc
atctggctggttcgggagggggaatga

DBGET integrated database retrieval system