KEGG   Enterobacteriaceae bacterium FGI 57: D782_0299Help
Entry
D782_0299         CDS       T02431                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ebf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328100..330181
Genome map
AA seq 693 aa AA seqDB search
MESKRLDNAALAAGISPNYINAHGKPQSIGADTKRRLLDAMHATATKVAVTPVPNVMVWT
HGKKMALTVEGSGEFHWLLTTEEGKQYQGEATGGKNLALPARLPEGYHSLTLTQSDERWH
CRVIVAPERCYEPLALKEKEKLWGACVQLYTLRSEKNWGIGDFGDLKAMLPEIAKRGGAF
IGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFQHSEEAQAWWKKPATQKAL
KAACDAVWVDYTAVTELKMTALRMAWTRFAKRTDAQMTQFRNFVEREGDSLYWQAAYDAL
HANQVKIDKLRWGWPAWPQAYQDVDSPEVRAFCEQHADEVDFYLWLQWLAYTQFAACWQE
SQQYDMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPH
IITARAYEPFIDLLRANMKNCGALRIDHVMSVLRLWWIPYGETADHGAYVHYPVDDLLSI
LALESKRHRCMVIGEDLGTVPVEIVGKLRKSGVYSYKVLYFENDSDKTFRAPKAYPEQSM
AVATTHDLPTLRGYWESGDLTLGRALGLYPDEVVLRGLYQDRELAKQGLLDALHKYGVLP
KRAGHKASLMSMTDTLNRGMQRYIADSNSALLGLQPEDWLNMEEPVNIPGTSDQYKNWRR
KLTTSLEQMFADERVNKLIKDLDKRRKAAGKKK
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaacgcctcgacaatgccgcgctggcggcggggatcagccccaactatatc
aatgcgcacggtaaaccgcagtctatcggtgctgacaccaaacggcgtttgctggacgca
atgcacgctaccgccacgaaagtggcggtgacgcccgtcccgaacgtcatggtctggacg
catggcaaaaaaatggctctgacggttgaaggcagcggcgagtttcactggctgctgacc
accgaagagggcaagcagtatcagggcgaagcgacaggaggcaaaaacctggcgctgccc
gcgcgtctgcctgagggctatcactcccttacgctgacccagtctgatgaacgctggcac
tgccgggtgattgttgccccggaacgctgctatgaaccgctggcgttgaaagagaaagaa
aaattgtggggcgcctgcgtgcagctctacaccctgcgttctgaaaagaactggggaatt
ggtgactttggcgacctgaaggcgatgctgccggaaatcgccaaacgcggcggggcgttt
atcggcctcaacccgatccacgcgctctatccggcgaacccggaaagcgcgagcccgtac
agcccttcatcccgccgctggctgaacgtgatttatatcgacgtcaacgcggtggaagat
ttccagcacagcgaagaagcgcaggcctggtggaaaaaaccggccacccagaaagcgctg
aaagccgcctgtgatgcggtgtgggttgactacacggcggttacagaactgaaaatgacc
gcgctgcgtatggcgtggacgcgttttgccaaacgcactgatgcgcagatgacccagttc
cgcaactttgttgaacgtgaaggagacagcctttactggcaggcggcgtatgacgcgctg
cacgccaatcaggtgaaaatcgacaaactgcgctggggctggcctgcctggccgcaagcg
tatcaggatgtcgatagcccggaagtgcgtgcgttctgtgagcagcatgccgatgaagtc
gatttctatctttggctgcaatggctggcgtacacccagttcgcggcctgctggcaggaa
agccagcaatatgacatgccgattggcctgtatcgcgacctcgccgtgggcgtggcggaa
ggcggcgcggaaacctggtgtgaccgcgagctttactgcctgaaagcgtcagtgggcgca
ccgccggatattctcgggccgctggggcaaaactggggcctgccgccgatggacccgcac
atcattaccgcgcgtgcctacgagccgtttatcgacctgctgcgcgcgaatatgaaaaac
tgcggcgcgctgcgtatcgaccatgtgatgtccgtgctgcgtctgtggtggatcccttac
ggtgaaacggcggatcacggcgcgtacgtgcattatccggtggacgatctgctgtcgatt
ctggcgctggagagtaaacgccatcgctgcatggtgattggtgaagatctcggtaccgta
ccggtggagattgtcggcaaactgcgcaaaagcggagtttactcatacaaagtgctctac
ttcgaaaacgacagcgacaaaaccttccgtgcgccaaaagcgtatccggagcaatccatg
gcggtcgccaccacccatgacctgccgacgctgcgcggttactgggaaagcggtgacctg
acgctcggtcgggcgctggggctttatcctgacgaagtggtgttacgtggtttgtaccag
gatcgcgaactggcgaagcagggcttgctggatgcgctgcacaaatatggcgtgctgcca
aaacgtgccgggcataaagccagcctgatgagcatgaccgacacgctcaatcgcggtatg
cagcgttacatcgctgacagcaatagcgcactgctggggctacaaccggaagactggctg
aatatggaagagccggtcaatatccccggtaccagcgatcagtacaaaaactggcggcgt
aagctgaccaccagtcttgagcagatgtttgccgatgaacgggtgaataagctgattaag
gacctggataagcggcgcaaagcggcaggcaagaagaagtaa

DBGET integrated database retrieval system