KEGG   Enterobacteriaceae bacterium FGI 57: D782_0820Help
Entry
D782_0820         CDS       T02431                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Brite
Enzymes [BR:ebf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     D782_0820
Secretion system [BR:ebf02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   D782_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834320..835033
Genome map
AA seq 237 aa AA seqDB search
MKKGLVMFTLLAAAFSATTHADDAAIKQSLAKLGVQSTDIQNAPVAGMKTVLTNSGVLYV
TEDGKHIIQGPMYDVSGAQPVNVTNQLLMTHLNALEKEMIVYKAPKEQHVITVFTDITCG
YCHKLHEEMSDYNALGITVRYLAFPRQGIQSQAEQDMKAIWCAKDRNKAFDDAMNGKGVQ
PASCDINIADHYALGVQFGVNGTPAIVLNDGYVVPGYQGPKEMKAFLDEHKKQTSGK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttagtgatgtttaccctgctggcggcggctttttccgccaccacccac
gcggatgatgcggcgattaaacagtcgctggctaaactgggcgtacagagcaccgatatc
cagaatgcgccggtcgcggggatgaaaaccgtgctgaccaacagcggtgtgctgtatgtc
accgaagatggtaaacacattattcaggggccgatgtatgacgtcagcggcgcgcagccg
gttaacgtcaccaatcaactgctgatgacccatctcaacgccctggaaaaagagatgatt
gtctacaaggcgccgaaagagcagcacgtgattaccgtctttaccgatatcacctgcggc
tactgccacaaactgcatgaagagatgagcgactacaacgcgctggggatcaccgtgcgt
tacctcgccttcccgcgccagggcattcagagccaggccgagcaggacatgaaagcgatt
tggtgcgcgaaagatcgcaacaaagcctttgatgacgcgatgaacggtaaaggcgtgcag
cctgccagctgcgatatcaacatcgcggatcactacgcgctgggcgtacagtttggcgtc
aacggtacgccggcgattgtcctgaacgatggctacgttgtgccgggttatcaggggccg
aaagagatgaaagccttcctcgacgaacacaaaaaacagaccagcggtaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system