KEGG   Enterobacteriaceae bacterium FGI 57: D782_0902Help
Entry
D782_0902         CDS       T02431                                 

Definition
DNA helicase/exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ebf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
919532..921367
Genome map
AA seq 611 aa AA seqDB search
MSLENLLIEAAELKLLRPLDVQFALTIARHEHPAVMLAAAILSRDAGEGHVCLPLSHLQH
APTLNGRAKDLWTQLLDAVEMPDDWAALLLASQAVSQGERPTPLILCGDRLYLNRMWGNE
RSVARFFRDAQLAEPIDESLIAETLADLFPPSDTIDWQKVAAAVALTRRISVISGGPGTG
KTTTVAKLLAALVRIAGENKCRIRLAAPTGKAAARLTESLGAALRKLPLTEAQKTMLPTD
ASTLHRLLGAQPGSQRMRYHAGNPLHLDVLVVDEASMIDLPMMARLIDALPRHGRVIFLG
DRDQLASVEAGAVLGDICAWVNSGYTPYRALQLSRLTGTTVPEGEGEAAGALRDSLCLLR
TSYRFGSDSGIGQLARAVNLGDREGVRDVFARGFTDIELKSLRTSDEYEAMLDDARAGYG
RYLQCLRQQADPAEILQAFGEYQLLCALREGPWGVSGLNQQLELSLVRHRMIAPQRHSRW
YEGRPVMIARNDSALGLFNGDIGVALDRGQGLRVWFPMPDGTIKSVQPSRLPEHDTAWAM
TVHKSQGSEFEHAALVLPTQPVPVVTRELVYTAITRAKSRLSMYADAALLGQAIVARTER
RSGLAAIFAED
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctggaaaatttattgattgaagccgcggagctaaagctattgcgcccactggat
gtgcagtttgcgctgactatcgctcgccatgagcatcccgccgtgatgctggcggcggcc
attttgagccgcgacgccggagaggggcacgtttgcctgccgctcagccatttgcagcac
gcgccgacgctgaacgggcgagcaaaagacttgtggacgcaactgctggacgcggtcgaa
atgcctgacgactgggcggccctgctattggcctcgcaggcggtgagccagggcgagcgc
ccgacgccgctaatcctgtgcggggaccgtctgtatctgaaccgcatgtggggtaatgaa
cgtagcgtcgcgcgtttcttccgcgatgcgcagcttgcagagcctattgatgaatcgctg
attgccgagacgctcgccgatcttttcccgccatccgataccatcgactggcaaaaagtc
gccgccgccgtcgcgctcacccgacgcatttcggttatctcaggcgggcccggcaccggg
aaaaccaccaccgtagcaaaactgctggcggcgctggtgcgcattgcaggagagaataaa
tgccgtattcgcctggcggcgccgacagggaaagccgcggcgcgactcaccgaatcgctg
ggcgcagcgctgcgcaaattgccattaacagaagctcagaaaacgatgttgccaaccgat
gccagtacgctgcatcgtctgttaggcgcgcagccgggcagccagcgcatgcgttatcat
gcgggaaacccgctgcatctggatgtgctggtggtggacgaagcctcaatgattgacctg
ccgatgatggcgcgcttgattgacgcgctgccgcgtcacgggcgggtgattttccttggt
gaccgcgaccagctggcctccgtcgaagcgggtgcggtgctgggcgatatctgtgcgtgg
gttaacagcggctatacgccgtatcgcgctcttcaactgagtcgcctgacaggcacgacg
gtgccggaaggggaaggagaggcggctggcgcattgcgtgacagcctttgcctgctgcgt
accagctatcgtttcggcagtgattccgggatagggcaactggcgcgcgcggtgaatctg
ggcgatcgcgagggcgtgcgtgacgtctttgcacgcggctttacggatatcgaactgaaa
tccctgcgcaccagcgacgagtatgaagcgatgctcgacgatgcgcgcgcgggctatggg
cgctatctgcaatgcctgcgccagcaggccgacccggctgaaattttgcaggcctttggt
gagtatcagctcctgtgcgccctgcgcgaagggccgtggggcgtcagcgggttgaatcaa
cagctcgaactctcgctggtgcgccatcgcatgattgcgccgcaacggcattctcgctgg
tatgaagggcgtccggtgatgatcgcccgaaacgacagtgcgttggggctgtttaacggt
gacattggcgtggcgctcgatcgcggacaggggctacgcgtctggttcccgatgccggat
ggaaccataaaatcggtgcagccgagtcgtttgcccgagcacgatacggcgtgggcgatg
acggtgcataaatcgcagggttctgaattcgagcatgccgcgctggttttgccgacgcag
ccggtgccggttgtgacgcgggaactggtgtatacggcgattacgcgtgcgaaatcacgc
ttgtcgatgtatgccgatgcggcgttgttagggcaggcgatcgtcgccagaaccgagcgt
cgcagcgggctggcggcgattttcgccgaggattaa

DBGET integrated database retrieval system