KEGG   Enterobacteriaceae bacterium FGI 57: D782_1265Help
Entry
D782_1265         CDS       T02431                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D782_1265
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D782_1265
   00052 Galactose metabolism
    D782_1265
   00500 Starch and sucrose metabolism
    D782_1265
   00520 Amino sugar and nucleotide sugar metabolism
    D782_1265
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    D782_1265
   00524 Butirosin and neomycin biosynthesis
    D782_1265
Enzymes [BR:ebf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     D782_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1306061..1307026
Genome map
AA seq 321 aa AA seqDB search
MTKFALTGDVGGTNARLALCDLATGEISQAKTYSGLDYPSLEAVVRVYLKEHNVEVEDAC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFAHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
IGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPKDITQRALEDTCIDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKAYVQDIPVYLIV
HDNPGLLGSGAHLRQTLGQIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtttgcattaacaggagacgtcgggggcaccaacgcgcgtttagcgttatgt
gacctcgccacgggcgaaatctcgcaggcgaagacctactcaggcctggattacccaagc
ctcgaagcggtggtccgcgtctatctcaaagaacacaatgtggaagtggaagacgcctgc
atcgccattgcctgcccgattaccggtgactgggtggcgatgaccaaccacacctgggcc
ttctccattgcagaaatgaagaagaatctcggctttgcgcacctggaaattattaatgat
ttcaccgccgtgtcgatggctatcccgatgctgaaaaaagagcacctgattcagttcggc
ggcgcggaaccggtagagggcaaaccgattgcggtttatggtgccggcaccgggctaggt
gtcgcgcatctggttcacgttgacaagcgttgggtcagcctgccgggcgagggcggccac
gtcgatttcgcgccgaacagcgaagaagaggggattatccttgaagagctgcgggcggaa
atcggtcatgtctctgcggaacgtgtgctttccgggccggggttggtgaatctgtatcgc
gcgattgtgaaatctgacggccgtctgccggaaaacttacagccgaaagacatcactcag
cgtgcgctggaagatacctgcatcgactgtcgccgcgcgctgtcgctgttctgcgtcatc
atgggccgctttggcggcaacctggcgctgacgctcggcacttttggtggcgtctatatc
gcgggcggcatcgtaccgcgcttccttgagttctttaaagcgtccggcttccgtggcggt
tttgaggataaaggccgtttcaaagcctacgtgcaggatatcccggtctatctgattgtt
cacgataaccctggcctgctcggctccggggcgcacctgcgccagacgctggggcaaatt
ctgtaa

DBGET integrated database retrieval system