KEGG   Enterobacteriaceae bacterium FGI 57: D782_1370Help
Entry
D782_1370         CDS       T02431                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ebf00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1411524..1412153)
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEVELPYRLIRVDINKGEQFKPQFLDISPNNKIPAIVDHQP
EDGGAPFSLFESGAILLYLAEKSGKLLSGELRERHTTLQWLFWQVGGLGPMLGQNHHFNH
FAPQPVPYAIERYQVETQRLYSVLNQRLASHPWIAGDHYSIADIACWPWVNSHQRQRIDL
ATYPAVQNWFERIRQRPATARAMQQAQPH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatagacctttactatgcgcccaccccgaacggccacaaaattacccttttccttgaa
gaggtagagctgccctaccgtttgattcgcgtcgatatcaataaaggcgagcagtttaag
ccgcaatttctcgatatttcaccgaataacaaaatcccggccattgtggatcatcaaccg
gaggatggcggtgcgccgttcagcctgtttgaatccggggccatcctcctctatctggca
gaaaaatccggtaaattgctgagcggcgaactgcgcgagcgccatacgacgttacagtgg
ttgttctggcaggtcggcggtcttggcccgatgctggggcaaaaccaccattttaatcac
ttcgccccgcagcccgttccctacgccattgagcgataccaggtggaaacccagcgcctg
tatagcgtgctgaatcaacgccttgccagtcacccgtggatagcgggcgatcactacagc
attgccgatatcgcctgctggccgtgggtaaattcccaccagcggcaacgtatcgatctt
gccacctatccggcggtgcaaaactggtttgagcgcatccgccagcgcccggcaaccgcg
cgtgccatgcagcaggcgcagccccattaa

DBGET integrated database retrieval system