KEGG   Enterobacteriaceae bacterium FGI 57: D782_1468Help
Entry
D782_1468         CDS       T02431                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D782_1468
Enzymes [BR:ebf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     D782_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1533393..1534139
Genome map
AA seq 248 aa AA seqDB search
MRGLTHNKCKLCPMKGEVPHLLEKEKMSSLSKEAALVHEALVARGLETPLRPPVREMDNE
TRKRLISGHMTEIMQLLNLDLSDDSLMETPHRIAKMYVDEIFSGLDYANFPKITVIENKM
KVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKESVIGLSKINRIVQFFAQRPQVQER
LTQQILTALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRQEF
LRAVRHHN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcggcctcacgcacaataagtgcaaactttgccccatgaagggcgaagtgccccac
ctgctggagaaagaaaagatgtcatcactgagtaaagaagctgcactggttcatgaagcc
ctcgtggcccgtggactggaaacgccgctgcgcccgccggtgcgcgaaatggataatgaa
acccgtaagcgtctgatttcagggcatatgaccgagattatgcagttactgaatctcgat
ctgagtgatgacagtttgatggaaactccgcatcgcatcgccaaaatgtatgtggatgag
attttctctggcctcgattacgccaatttcccgaaaatcaccgtcattgaaaacaagatg
aaggttgatgaaatggtgaccgtgcgcgacatcaccctcaccagcacttgtgaacaccat
tttgtgaccatcgatggtaaagcgacggtggcgtacatcccgaaagagtcggtgattggc
ttgtccaaaatcaaccgtatcgtgcagtttttcgcccagcgcccgcaggtgcaggagcgt
ctgacgcagcaaattctcaccgcgctgcaaaccctgctcgggaccaacaacgtggcggtt
tccattgatgcggtgcattattgcgtgaaagcgcgcggtattcgcgatgctaccagcgcc
accaccaccacgtcgcttggcggcctgtttaaatccagccagaatacccgtcaggaattc
ttgcgcgccgtacgccaccacaactaa

DBGET integrated database retrieval system