KEGG   Enterobacteriaceae bacterium FGI 57: D782_1584Help
Entry
D782_1584         CDS       T02431                                 

Definition
UDP-glucose pyrophosphorylase regulatory subunit
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    D782_1584
   00052 Galactose metabolism
    D782_1584
   00500 Starch and sucrose metabolism
    D782_1584
   00520 Amino sugar and nucleotide sugar metabolism
    D782_1584
Enzymes [BR:ebf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     D782_1584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1665337..1666230
Genome map
AA seq 297 aa AA seqDB search
MVNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEVVAAGIKEIVLVTHASK
NAVENHFDTSYELEALLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPI
VGDNPFVVVLPDIILDGASADPLRYNLAAMVARYNETGRSQVLAKRMPGDLSEYSVIQTK
EPLTVEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSADIWAELEKTAPGAWGRIQLTD
AIAELAKKQSVDAMLMSGDSYDCGKKMGYMQAFVQYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggttaatttgaaagcagtcattccggtagccgggctgggcatgcatatgctccctgcc
accaaggccattcctaaagagatgctaccgatcgttgacaagccgatgatccaatacatc
gtcgacgaagttgttgctgcagggatcaaagaaatcgtcctggtcacccacgcgtctaaa
aatgccgtggaaaaccacttcgacacctcctacgaactggaagctctgctggagcaacgc
gtgaagcgtcagctgctggcggaagttcagtccatttgcccaccgggcgtaaccatcatg
aacgtgcgtcaggcacagccgctgggcctgggccactccattctgtgtgcgcgtccgatc
gttggcgataacccgtttgtggttgttctgcccgatatcattcttgatggcgcatccgcc
gacccgttgcgttataaccttgccgcgatggttgcacgctataacgaaactggccgcagc
caggtgctggcgaaacgtatgccgggcgatctttctgaatactcggttattcagaccaaa
gagccgctgaccgtagaaggtaaggtgagccgtatcgtcgagttcatcgaaaaaccggat
caaccgcaaacgctggattccgacctgatggccgtagggcgctatgtgctttccgctgac
atttgggccgaactggaaaaaaccgcgccgggtgcctggggccgtattcagctgacggat
gctatcgccgaactggcgaagaaacagtccgttgatgcgatgctgatgagcggcgacagc
tacgactgcggtaagaaaatgggttacatgcaggcgttcgtccagtacgggctgcgcaac
ctgaaagaaggggcgaagttccgcaaagggattgagaaactgctgtcagaataa

DBGET integrated database retrieval system