KEGG   Enterobacteriaceae bacterium FGI 57: D782_1606Help
Entry
D782_1606         CDS       T02431                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00340  Histidine metabolism
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01230  Biosynthesis of amino acids
Module
ebf_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    D782_1606
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     D782_1606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGB77614
UniProt: L0M116
Position
complement(1688834..1690138)
Genome map
AA seq 434 aa AA seqDB search
MSFNTLIDWNGCNKEEQQALLMRPAISASDSITRTVAEILDNVKQNGDRALREYSAKFDK
TDVTALKVTEDEIAEASRRLSDELKAAMKVAVKNIDTFHTAQILPGVDIETQSGVRCQQV
TRPIASVGLYIPGGSAPLFSTVLMLATPARIAGCQKVVLCSPPPIADEILYAAQLCGVKE
VFKVGGAQAIAALALGTESIPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFIAADLLSQAEHGPDSQVILLTPDADIARGVAEAVERQLTELSRADTARQ
ALSASRLIVARDIAQCVEISNAYGPEHLIIQTRNARDLVDNITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSRDGFASLAATIETLAAAELLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacaccctgatcgactggaatggttgtaataaggaagagcagcaggcgctg
ctgatgcgcccggcaatttcggcttccgacagcattacgcgcaccgtcgcggagatcctg
gataacgttaagcaaaacggcgaccgcgccctgcgcgaatacagcgcgaaatttgataaa
accgacgtgactgcgctgaaagtcaccgaagatgagattgccgaggccagccgtcgcctt
agcgatgaactgaaagccgcgatgaaggtcgcagtgaaaaatatcgataccttccacacc
gcgcaaattctgccaggtgtggatatcgaaacccagtcgggcgtgcgctgccagcaggtt
acgcgccctatcgcctcggtgggcctctatattccaggcggttctgcgccgctcttctct
accgtcttaatgctggcgacgccggcgcgcattgccggttgccagaaagtggtgctctgc
tcgccaccaccgattgccgatgaaattctgtatgccgcacaactgtgcggtgtgaaagag
gtgtttaaagtcggcggcgcacaggccatcgccgcactggcactcggtaccgagtcaatt
ccgaaggtggataaaatttttgggccgggcaacgcttttgtgactgaagccaaacgccag
gttagccagcgtctggacggtgccgccatcgacatgccagcgggcccgtctgaagtactg
gtgattgccgacagcggcgcgacgccggactttatcgccgccgacctcctttcgcaagcc
gaacacggccctgattcgcaggtgatcctgctaacgccagacgccgacatcgcgcgtggc
gtggcggaagccgtggaacgtcagcttacggagctttcccgtgccgacaccgcgcgtcag
gcgctttccgccagccgtttgattgtcgctcgcgacatcgcccagtgcgtggaaatttcc
aacgcctacggcccggagcacctgatcattcagacccgcaacgcccgtgacctggtggac
aatatcaccagcgcaggctccgttttcctcggcgactggtcgccggaatcggcaggcgat
tacgcctccggcacgaaccacgtgctgccgacgtacggttacaccgcaacctgctccagc
ctggggctggcggatttccagaaacgcatgaccgtgcaggagctctcccgcgacggtttt
gcgtctctcgccgccaccattgaaacgctggccgcagccgaactgctgaccgcccacaaa
aatgccgtcaccctgcgcgtaaacgccctgaaggagcaagcatga

DBGET integrated database retrieval system