KEGG   Enterobacteriaceae bacterium FGI 57: D782_1751Help
Entry
D782_1751         CDS       T02431                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    D782_1751
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    D782_1751
Enzymes [BR:ebf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     D782_1751
Two-component system [BR:ebf02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   D782_1751
Bacterial motility proteins [BR:ebf02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    D782_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1821405..1822454
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMIATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAVDFVTKPQLGIREGMLAYS
EMIADKVRAAARAQISAHKTLAAPATLKSGPLLSSEKLIAIGASTGGTEAIRHVLQPLPV
TSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHLELARSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAQYAGRNAVGVILTGMGNDGAAGMREMRQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQISQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagggtgctgtcggtggatgattccgcgctgatgcggcaaatcatgacc
gagattatcaacagccacagcgatatggagatgattgctactgcgccagatccgctggtg
gcgcgcgatctgatcaaaaaatttaaccccgacgttctgacgctcgatgtcgagatgccg
cgcatggatggcctcgattttctagagaagctgatgcgtctgcgtccgatgccggtggtg
atggtctcctcgctaaccggcaaaggttcggaagtgacactgcgcgcgctggagctgggg
gcggtggattttgtcaccaaaccacagctgggtatccgcgaagggatgctggcctacagc
gaaatgattgccgacaaagtgcgcgcggcggcgcgggcgcaaatttccgcgcataaaacg
ttagccgcaccggccaccttaaaaagcgggccattgctgagctcggaaaagctgattgct
attggggcatcgaccggtggaacagaggcgattcgccatgtgctgcaaccgctgccggtg
accagccctgcgttattgatcacccagcatatgccgccgggctttacgcgatcttttgcc
gaccgtctcaataagctgtgccagattggcgtgaaagaagcggaagacggcgaacgcgtc
ttgccagggcatgcttatatcgcgccgggcgatcgtcatcttgagctggcacgcagcggg
gcgaactatcaaatcaaaattcacgacggaccggcggtgaatcgccatcgcccgtcggtg
gatgtgctgtttcattccgttgctcagtacgcagggcgcaatgccgttggcgtgatcctc
accgggatgggtaacgacggtgcggcaggaatgcgggagatgcgccaggcgggcgcctgg
accattgcccagaacgaagccagttgtgtggtgttcggcatgccgcgcgaagccatcaat
atgggtggcgtcagcgaagtggtcgatctcagtcagataagccagcaaatgctggccaaa
atcagtgccggacaggcaatacgtatataa

DBGET integrated database retrieval system