KEGG   Enterobacteriaceae bacterium FGI 57: D782_1751Help
Entry
D782_1751         CDS       T02431                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ebf02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ebf02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1821405..1822454
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMIATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAVDFVTKPQLGIREGMLAYS
EMIADKVRAAARAQISAHKTLAAPATLKSGPLLSSEKLIAIGASTGGTEAIRHVLQPLPV
TSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHLELARSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAQYAGRNAVGVILTGMGNDGAAGMREMRQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQISQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagggtgctgtcggtggatgattccgcgctgatgcggcaaatcatgacc
gagattatcaacagccacagcgatatggagatgattgctactgcgccagatccgctggtg
gcgcgcgatctgatcaaaaaatttaaccccgacgttctgacgctcgatgtcgagatgccg
cgcatggatggcctcgattttctagagaagctgatgcgtctgcgtccgatgccggtggtg
atggtctcctcgctaaccggcaaaggttcggaagtgacactgcgcgcgctggagctgggg
gcggtggattttgtcaccaaaccacagctgggtatccgcgaagggatgctggcctacagc
gaaatgattgccgacaaagtgcgcgcggcggcgcgggcgcaaatttccgcgcataaaacg
ttagccgcaccggccaccttaaaaagcgggccattgctgagctcggaaaagctgattgct
attggggcatcgaccggtggaacagaggcgattcgccatgtgctgcaaccgctgccggtg
accagccctgcgttattgatcacccagcatatgccgccgggctttacgcgatcttttgcc
gaccgtctcaataagctgtgccagattggcgtgaaagaagcggaagacggcgaacgcgtc
ttgccagggcatgcttatatcgcgccgggcgatcgtcatcttgagctggcacgcagcggg
gcgaactatcaaatcaaaattcacgacggaccggcggtgaatcgccatcgcccgtcggtg
gatgtgctgtttcattccgttgctcagtacgcagggcgcaatgccgttggcgtgatcctc
accgggatgggtaacgacggtgcggcaggaatgcgggagatgcgccaggcgggcgcctgg
accattgcccagaacgaagccagttgtgtggtgttcggcatgccgcgcgaagccatcaat
atgggtggcgtcagcgaagtggtcgatctcagtcagataagccagcaaatgctggccaaa
atcagtgccggacaggcaatacgtatataa

DBGET integrated database retrieval system