KEGG   Enterobacteriaceae bacterium FGI 57: D782_1785Help
Entry
D782_1785         CDS       T02431                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ebf00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ebf00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ebf00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1854674..1856788)
Genome map
AA seq 704 aa AA seqDB search
MDPTHFLSGKTSALCIDTSNGGEILYWGRILGNSDAAKIALSRAVPYGRLDVDTPVSLMA
ENGRGLFGSPGIEGHRNGKHWSPVFTITQVEENEEGLQIHSEDRAAGLRVTTHLLFDSDT
DVIRIRHTLTNTDARAYDVSRLAVTLPLPERANECLSFYGRWVYEFQQHRHSLHHGGYQQ
ENRRGRTSHQHYPALICGTEGFGENHGELWGFHFAWSGNHRMRVDVKADGRRVLQAEALY
VPGEIVLQTQESVSTPWLYATWSGQGLNGMSQQFHRYVRRQLLSFTSAQPRQVHLNTWEG
IYFDHNPEYIMQMATQAAEMGVERFIIDDGWFTGRNDDKAALGDWFVDEDKYPQGLEPVI
AHVLNQGMTFGLWVEPEMISKNSALYRQHPDWLLQLSDYEQPTGRNQYVLDLCNEAVFTY
LYERLDDLLNRYDISYLKWDMNREVVQPGHQARPAQTRQVERLYDLMSMLHAKHPTVDIE
SCAAGGGRIDYEILRHVQRFWPSDNNDALERLSIQRGFSYFFPPEVMGAHIGAKKSHSTR
RVSDIHFRGITALFGHLGVELDPLQATEEDKKGFSRYINIYKQYRPLIHEGTLYRLDSDD
PQAQNITAIVSPNRRQALVVIAQRTMPTWALSGTLRIQGLEPQTAYKVSVIDAASNFKCG
IVSTQPAWVTEGVTLTGEWLQYAGLAMPVLDPESAVLLRVEALH
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggaccccacccactttctctcaggtaagacttctgctctatgtatcgataccagcaac
ggcggcgaaatcctttactgggggcggatactgggtaatagcgatgcggcaaaaatcgcc
ctttcccgcgcggtcccctatggtcggttagatgttgacacgccggtctcgctaatggcg
gaaaacggtcgcggtctgttcggcagcccgggcattgaaggccaccgcaacggcaaacac
tggtcgccagtgtttaccattacgcaggtggaggaaaatgaggaaggcttacagatccac
agtgaagatcgcgcggcaggcctacgcgtcactacgcatctgctgtttgactcagacacc
gacgttatccgcattcgccatacattaacgaatacagacgccagagcctacgacgtctcg
cgtctggctgtcaccctccccctacctgaacgggctaacgagtgcctctctttctatggt
cgatgggtgtatgaattccagcagcaccgtcactcactgcaccacggaggctatcagcag
gagaaccgccgggggcgaacttcacatcagcactatcccgccttaatttgtggcactgaa
ggcttcggcgaaaaccatggcgagctctggggctttcacttcgcctggagcggcaatcat
cgcatgcgtgttgatgttaaagccgatggtcggcgcgtgttacaagctgaagcgctatac
gtaccgggtgaaatcgtgctccagactcaggaatccgtctccacgccgtggctttacgcc
acctggagtggtcagggcctgaacggcatgagtcagcagttccaccgctacgtacgccgc
cagttactcagcttcacttcagcacagccacgccaggtacatcttaatacatgggaaggg
atctacttcgatcacaatccggaatacatcatgcagatggccactcaggccgccgagatg
ggagtcgagcgttttattattgatgatggctggtttactggtcgcaacgatgataaagcc
gcactgggagactggtttgttgatgaggacaagtacccgcaggggctcgaacccgtgatt
gcacacgtgctgaatcaaggtatgacgttcggcctgtgggttgaacctgaaatgatcagc
aaaaattcagccctctatcgccaacatccggactggctgctgcaattaagcgactacgag
cagccgaccggccgcaaccagtacgttctggatttgtgtaatgaagccgtcttcacctat
ctgtacgagcgtcttgacgatctgcttaaccgttatgatatttcgtacttgaaatgggat
atgaatcgtgaagttgttcagcccggtcatcaggctcgcccggcgcagacacgtcaggta
gaacgtctctacgacctgatgtccatgctgcatgcaaaacatcccacggttgatattgag
tcctgcgccgcaggtggcgggcgtatcgactacgaaatacttcgtcatgtacagcgcttc
tggccatcagacaataatgatgcgctggaacgcctctccatccagcgcggttttagctat
tttttcccaccggaagttatgggtgcgcatattggcgcgaaaaagagccactccacacgc
cgggtttccgatatccatttccgcggtattaccgccctctttggccatctcggcgtagaa
ctcgatccactgcaggccaccgaggaggataaaaaaggcttcagccgttacatcaacatc
tacaaacagtatcggccactgattcacgaaggcacgctgtaccgcctcgacagtgatgat
ccacaagcacaaaacatcactgccatcgtgtcccccaatcgccggcaggcgctggtagtc
attgctcagagaacaatgccgacatgggcacttagcggcacgctgcgcatccaggggttg
gaaccgcaaactgcctacaaggtgagcgttatcgatgccgccagcaacttcaagtgtggc
attgtcagcacccaaccagcatgggtgactgagggcgtcacattgacgggcgagtggctg
caatatgccgggctggcaatgcccgtattggacccggaatccgccgtactgctgcgggtt
gaagcacttcattaa

DBGET integrated database retrieval system