KEGG   Enterobacteriaceae bacterium FGI 57: D782_1916Help
Entry
D782_1916         CDS       T02431                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    D782_1916
   00052 Galactose metabolism
    D782_1916
   00500 Starch and sucrose metabolism
    D782_1916
   00520 Amino sugar and nucleotide sugar metabolism
    D782_1916
Enzymes [BR:ebf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     D782_1916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1997698..1998606
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVTKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEFESDLSQDNLAEMIKRFDETGSSQIMVEPVEDVTAYGV
VDCKGAPLAPGDSVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGVRHKTLGEEFTGWLKDTLGV
AK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctaaattcgaaagtgactaaggccgttatcccggtagcgggattaggtacc
aggatgttacctgctacgaaggcaattcctaaggaaatgctgccgctggtagataaacca
ttaattcagtatgtggtaaatgaatgtatcgccgcaggtatcactgaaattgtgctggtc
actcactcttccaagaattcgattgaaaaccattttgacaccagcttcgaactggaagct
atgctggaaaaacgcgttaagcgtcagctgctggaagaagtgcaatctatttgcccgccg
cacgtaaccattatgcaggtgcgtcagggcctggctaaaggtctgggacacgccgtatta
tgcgcgcatccagttgtgggtgatgagccagtcgcggttattctgccggacgttattctg
gatgaatttgaatccgatctgtctcaggataacctggcggaaatgatcaaacgctttgat
gaaacaggttcaagccagattatggttgagccggttgaagatgttaccgcttacggcgtg
gttgactgtaaaggtgctccattggcaccgggcgacagcgtaccgatggttggcgtggtt
gagaaaccaaaagctgatgtcgcaccgtctaacctggctatcgttgggcgttatgtcctg
agcgctgatatttggccgctgctggcaaaaacacctccgggagccggtgatgaaattcag
ctgaccgatgctatcgatatgctgatcgagaaagaaaccgttgaagcctatcatatgaaa
ggcaaaagccatgactgcggtaataaactgggttatatgcaggctttcgttgaatatggc
gttcgtcataagacactgggtgaagaattcactgggtggcttaaagacacgctgggcgta
gcgaagtaa

DBGET integrated database retrieval system