KEGG   Enterobacteriaceae bacterium FGI 57: D782_1918Help
Entry
D782_1918         CDS       T02431                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ebf00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2000053..2000682
Genome map
AA seq 209 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQGSQLFDEISAENAREAVNCVLVDECQFLTRQQVYALSDVVDLLDIPVLCYGLRTDF
RGELFGGSQYLLALSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALEEGSLAVIQDKHRHCRHPA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactttatttctactattctgcaatgaacgcaggtaagtctacggcgctattg
cagtcatcatacaattaccaggagcgcgggatgcgtaccgtggtttataccgccgaaatt
gacgaccgttttggcgcaggtaaagtgagctcgcgtatcgggctctcctcgccggcaaag
ctgtttaaccagggtagccagctctttgacgaaattagcgctgagaacgcgcgtgaggcg
gttaactgcgtgctggtggatgaatgccagttcctgacgcgtcaacaggtctacgcgctc
tctgacgttgtcgatctgctcgatattcctgttttatgctatggcttacgtactgacttc
cgcggtgagctgtttggcggcagccagtatttactggcgctatcagacaagctggtggag
ttaaaaacgatttgtttctgcggccgtaaagccagcatggtgttgcgtcttgatcaagca
ggccgcccttataatgaaggcgagcaggtggtgattggcggaaatgagcgttacgtctcc
gtctgtcgtaaacactataaagaagcgctggaagagggctctttggccgttattcaggat
aagcaccgtcactgccgtcaccctgcctga

DBGET integrated database retrieval system