KEGG   Enterobacteriaceae bacterium FGI 57: D782_1918Help
Entry
D782_1918         CDS       T02431                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    D782_1918
Enzymes [BR:ebf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     D782_1918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2000053..2000682
Genome map
AA seq 209 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQGSQLFDEISAENAREAVNCVLVDECQFLTRQQVYALSDVVDLLDIPVLCYGLRTDF
RGELFGGSQYLLALSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALEEGSLAVIQDKHRHCRHPA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactttatttctactattctgcaatgaacgcaggtaagtctacggcgctattg
cagtcatcatacaattaccaggagcgcgggatgcgtaccgtggtttataccgccgaaatt
gacgaccgttttggcgcaggtaaagtgagctcgcgtatcgggctctcctcgccggcaaag
ctgtttaaccagggtagccagctctttgacgaaattagcgctgagaacgcgcgtgaggcg
gttaactgcgtgctggtggatgaatgccagttcctgacgcgtcaacaggtctacgcgctc
tctgacgttgtcgatctgctcgatattcctgttttatgctatggcttacgtactgacttc
cgcggtgagctgtttggcggcagccagtatttactggcgctatcagacaagctggtggag
ttaaaaacgatttgtttctgcggccgtaaagccagcatggtgttgcgtcttgatcaagca
ggccgcccttataatgaaggcgagcaggtggtgattggcggaaatgagcgttacgtctcc
gtctgtcgtaaacactataaagaagcgctggaagagggctctttggccgttattcaggat
aagcaccgtcactgccgtcaccctgcctga

DBGET integrated database retrieval system