KEGG   Enterobacteriaceae bacterium FGI 57: D782_1986Help
Entry
D782_1986         CDS       T02431                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00360  Phenylalanine metabolism
ebf00362  Benzoate degradation
ebf00620  Pyruvate metabolism
ebf00621  Dioxin degradation
ebf00622  Xylene degradation
ebf00650  Butanoate metabolism
ebf01100  Metabolic pathways
ebf01120  Microbial metabolism in diverse environments
ebf01220  Degradation of aromatic compounds
Module
ebf_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    D782_1986
   00650 Butanoate metabolism
    D782_1986
  Amino acid metabolism
   00360 Phenylalanine metabolism
    D782_1986
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D782_1986
   00622 Xylene degradation
    D782_1986
   00621 Dioxin degradation
    D782_1986
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     D782_1986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AGB77973
UniProt: L0M278
Position
2072965..2073915
Genome map
AA seq 316 aa AA seqDB search
MSKIKVAIIGSGNIGTDLMIKILRNGKHLEMAVMVGIDPESDGLARARRMGVATTHEGVN
GLMAMPEFADIDIVFDATSAGAHVKNDAALRAKKPTIRLIDLTPAAIGPYCVPVVNLDKN
LSQGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIIASISSKSAGPGTRANIDEFTETTSQ
AIEVVGGAAKGKAIIILNPAEPPVMMRDTVYVLSEDASQIEIEASIEEMAAAVQAYVPGY
RLKQKVQFEIIPQDKPVTIPGIGQFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAAMST
AEKMAQTMVKAAGEVA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagataaaagtcgccatcatcggttcaggtaatatcggcaccgatctgatgatc
aaaattctgcgcaacggcaagcaccttgagatggcggtgatggtcgggatcgacccggag
tccgatggcctggcgcgcgcgcgccgtatgggcgtcgcgaccacccatgaaggcgtcaac
ggcctgatggccatgccggaattcgccgatattgatatcgtctttgacgctaccagcgcc
ggggcacacgtgaaaaatgacgccgcgctgcgggcgaagaaacccactattcgcctgatt
gacctgacgcctgcggcgattggcccgtactgcgtgccggtggtgaatctcgataaaaac
ctcagccagggcaacgtcaacatggtgacctgcggtgggcaggcgaccattcccatggtg
gcggcagtttcccgcgtggcgaaggtgcattacgcggaaatcatcgcctcgatttccagt
aagtccgccgggccgggcacacgcgctaatatcgacgaatttaccgaaaccacctcgcag
gccattgaagtggtgggcggcgcggcgaaaggcaaagccatcattattctcaacccggca
gagccgccggtgatgatgcgtgacacggtgtatgtgctgagcgaggacgcgtcgcaaatc
gaaattgaagcgtcgattgaagagatggccgccgccgtgcaggcgtatgtaccgggctac
cgcctgaagcaaaaagtgcagtttgaaattattccgcaggataaaccggtgaccattccg
ggtatcggccagttctccggcctgaaaacggcggtgtatctggaagtcgaaggcgcggcg
cactatctgcccgcctatgccggaaacctcgatatcatgacctcagcggcgatgtcgacg
gcggaaaaaatggcgcaaaccatggtgaaagcagcaggagaagtcgcatga

DBGET integrated database retrieval system