KEGG   Enterobacteriaceae bacterium FGI 57: D782_1986Help
Entry
D782_1986         CDS       T02431                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    D782_1986
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    D782_1986
   00650 Butanoate metabolism
    D782_1986
  Amino acid metabolism
   00360 Phenylalanine metabolism
    D782_1986
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D782_1986
   00622 Xylene degradation
    D782_1986
   00621 Dioxin degradation
    D782_1986
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     D782_1986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2072965..2073915
Genome map
AA seq 316 aa AA seqDB search
MSKIKVAIIGSGNIGTDLMIKILRNGKHLEMAVMVGIDPESDGLARARRMGVATTHEGVN
GLMAMPEFADIDIVFDATSAGAHVKNDAALRAKKPTIRLIDLTPAAIGPYCVPVVNLDKN
LSQGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIIASISSKSAGPGTRANIDEFTETTSQ
AIEVVGGAAKGKAIIILNPAEPPVMMRDTVYVLSEDASQIEIEASIEEMAAAVQAYVPGY
RLKQKVQFEIIPQDKPVTIPGIGQFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAAMST
AEKMAQTMVKAAGEVA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagataaaagtcgccatcatcggttcaggtaatatcggcaccgatctgatgatc
aaaattctgcgcaacggcaagcaccttgagatggcggtgatggtcgggatcgacccggag
tccgatggcctggcgcgcgcgcgccgtatgggcgtcgcgaccacccatgaaggcgtcaac
ggcctgatggccatgccggaattcgccgatattgatatcgtctttgacgctaccagcgcc
ggggcacacgtgaaaaatgacgccgcgctgcgggcgaagaaacccactattcgcctgatt
gacctgacgcctgcggcgattggcccgtactgcgtgccggtggtgaatctcgataaaaac
ctcagccagggcaacgtcaacatggtgacctgcggtgggcaggcgaccattcccatggtg
gcggcagtttcccgcgtggcgaaggtgcattacgcggaaatcatcgcctcgatttccagt
aagtccgccgggccgggcacacgcgctaatatcgacgaatttaccgaaaccacctcgcag
gccattgaagtggtgggcggcgcggcgaaaggcaaagccatcattattctcaacccggca
gagccgccggtgatgatgcgtgacacggtgtatgtgctgagcgaggacgcgtcgcaaatc
gaaattgaagcgtcgattgaagagatggccgccgccgtgcaggcgtatgtaccgggctac
cgcctgaagcaaaaagtgcagtttgaaattattccgcaggataaaccggtgaccattccg
ggtatcggccagttctccggcctgaaaacggcggtgtatctggaagtcgaaggcgcggcg
cactatctgcccgcctatgccggaaacctcgatatcatgacctcagcggcgatgtcgacg
gcggaaaaaatggcgcaaaccatggtgaaagcagcaggagaagtcgcatga

DBGET integrated database retrieval system