KEGG   Enterobacteriaceae bacterium FGI 57: D782_1986Help
Entry
D782_1986         CDS       T02431                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ebf00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ebf00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:ebf00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:ebf00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:ebf00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2072965..2073915
Genome map
AA seq 316 aa AA seqDB search
MSKIKVAIIGSGNIGTDLMIKILRNGKHLEMAVMVGIDPESDGLARARRMGVATTHEGVN
GLMAMPEFADIDIVFDATSAGAHVKNDAALRAKKPTIRLIDLTPAAIGPYCVPVVNLDKN
LSQGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIIASISSKSAGPGTRANIDEFTETTSQ
AIEVVGGAAKGKAIIILNPAEPPVMMRDTVYVLSEDASQIEIEASIEEMAAAVQAYVPGY
RLKQKVQFEIIPQDKPVTIPGIGQFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAAMST
AEKMAQTMVKAAGEVA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagataaaagtcgccatcatcggttcaggtaatatcggcaccgatctgatgatc
aaaattctgcgcaacggcaagcaccttgagatggcggtgatggtcgggatcgacccggag
tccgatggcctggcgcgcgcgcgccgtatgggcgtcgcgaccacccatgaaggcgtcaac
ggcctgatggccatgccggaattcgccgatattgatatcgtctttgacgctaccagcgcc
ggggcacacgtgaaaaatgacgccgcgctgcgggcgaagaaacccactattcgcctgatt
gacctgacgcctgcggcgattggcccgtactgcgtgccggtggtgaatctcgataaaaac
ctcagccagggcaacgtcaacatggtgacctgcggtgggcaggcgaccattcccatggtg
gcggcagtttcccgcgtggcgaaggtgcattacgcggaaatcatcgcctcgatttccagt
aagtccgccgggccgggcacacgcgctaatatcgacgaatttaccgaaaccacctcgcag
gccattgaagtggtgggcggcgcggcgaaaggcaaagccatcattattctcaacccggca
gagccgccggtgatgatgcgtgacacggtgtatgtgctgagcgaggacgcgtcgcaaatc
gaaattgaagcgtcgattgaagagatggccgccgccgtgcaggcgtatgtaccgggctac
cgcctgaagcaaaaagtgcagtttgaaattattccgcaggataaaccggtgaccattccg
ggtatcggccagttctccggcctgaaaacggcggtgtatctggaagtcgaaggcgcggcg
cactatctgcccgcctatgccggaaacctcgatatcatgacctcagcggcgatgtcgacg
gcggaaaaaatggcgcaaaccatggtgaaagcagcaggagaagtcgcatga

DBGET integrated database retrieval system