KEGG   Enterobacteriaceae bacterium FGI 57: D782_1993Help
Entry
D782_1993         CDS       T02431                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    D782_1993
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    D782_1993
Enzymes [BR:ebf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     D782_1993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2078697..2079722
Genome map
AA seq 341 aa AA seqDB search
MGPVMLDVEGYELDVEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIREASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAAVLGEEEGGRLAVEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHADPQKALAMARHFIDGMHSAGMKTTGKHFPGHGAVTADSHKETP
HDPRREADIRAKDMAVFQTLITENKLDAIMPAHVIYSDVDPRPASGSPHWLKTVLRGELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPINAERV
TKLYHKGSFTRQALRDSARWKTVSAQLEQLHERWQDVKAGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccggtaatgttggatgtagaaggctacgagctggatgtggaagagcgcgagatt
ctggctcatccgctggtgggtggcctgattttatttacccgtaactatcatgatccggcg
cagctgcgcgaactggtgcgccagatccgcgaggcgtcgcgcaatcatctggtggtggcg
gtcgatcaggaaggcggtcgggtgcagcgtttccgtgaaggttttactcgcctgcctgcc
gcacaatcttttgccgccgtactcggcgaggaagagggcggacgcctggcggttgaggcc
ggttggctgatggccagcgaaatgatcgccatggatattgatatcagcttcgccccggtg
ctggacgtcgggcatatcagcgctgcaatcggcgagcgctcctatcatgcggatccgcaa
aaagcgctggcgatggcgcgtcattttatcgacggcatgcacagcgcaggtatgaaaact
accggtaaacacttccccggacacggggcggttaccgctgattctcataaagagacgccg
cacgatccgcgtcgcgaagccgacattcgcgcgaaagatatggcggtgttccagacgctg
attacggaaaacaaactcgatgccattatgcctgcgcacgtcatctacagcgatgttgac
ccgcgccctgcaagcggctcgccgcactggctgaaaaccgtgttgcgcggtgagttaggc
ttcgatggcgtgattttctccgacgatttgtcgatggaaggcgcggcgattatgggcagc
tacgccgagcgcggccaggcatcgctggatgcgggttgcgatatgatcctggtctgcaat
aatcgtaaaggagcggtcagcgttcttgataacctgtcgccgatcaatgctgaacgtgtt
acgaaattgtatcataaaggttcatttacacgtcaggcgttaagggattccgcccgctgg
aagacagtcagtgcgcaactggaacagctccacgaacgctggcaggacgtgaaggcaggc
cattaa

DBGET integrated database retrieval system