KEGG   Enterobacteriaceae bacterium FGI 57: D782_2069Help
Entry
D782_2069         CDS       T02431                                 

Definition
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00670  One carbon pool by folate
ebf00790  Folate biosynthesis
ebf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D782_2069
   00670 One carbon pool by folate
    D782_2069
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     D782_2069
    1.5.1.50  dihydromonapterin reductase
     D782_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AGB78052
UniProt: L0M427
Position
complement(2154297..2155019)
Genome map
AA seq 240 aa AA seqDB search
MGETLSRPILITGAGRRIGLALAHHLLNQQQPVIVSYRTHLPAIDVLEKAGAQCIQADFS
TDGGIITFAEEVKKRCNGLRAVIHNASTWVPESPRQPLSDVMHAMMQVHVNAPYLLNHAL
ESLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFAKKLAPEVKVNAIA
PSLILFNETDDAAYRQQALNKSLMKIAPGEKEIIDLVDYLLTSCYVTGRTFAVDGGRPLA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggagagacgctttcgcgcccaatcctcattaccggcgcgggccgtcgcattggtctg
gcgctggcccaccacttgctcaatcagcagcaaccggtgattgtcagctaccgcacccac
cttcctgccattgatgtgctggagaaagccggcgcacagtgtattcaggccgatttttcg
accgatggcggcattatcacttttgccgaagaggtgaaaaagcgctgtaacggcctgcgc
gcggtgattcataacgccagcacatgggtgccggaaagcccacgtcagccgctaagcgac
gtgatgcacgccatgatgcaggtgcacgtgaatgccccttacctgctgaaccatgcgctg
gaaagcctgctgcgcggccatgggcatgccgccagcgatattattcactttaccgattac
gtggtggagcgcggcagcgataaacatatcgcctacgccgccagtaaagcggcgctcgac
aatatgactcgttcattcgccaaaaaactggcgccggaggtcaaagtgaatgccatcgcg
ccgtcactaatcctgtttaatgaaaccgacgacgcagcttatcggcagcaggcactgaat
aaatcactgatgaaaattgcccctggtgagaaagagattatcgatctggtcgattatctg
ctcaccagttgttacgtgaccggacgcacctttgccgttgacggcgggcgaccgctcgct
taa

DBGET integrated database retrieval system