KEGG   Enterobacteriaceae bacterium FGI 57: D782_2142Help
Entry
D782_2142         CDS       T02431                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    D782_2142
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D782_2142
  Lipid metabolism
   00071 Fatty acid degradation
    D782_2142
  Amino acid metabolism
   00350 Tyrosine metabolism
    D782_2142
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    D782_2142
   00626 Naphthalene degradation
    D782_2142
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     D782_2142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2227032..2228042)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHQVDVTERTLRPLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGIVKEVGPGVTSLKPGDRASVAWFFQGCGHCEYCNSGNETLCREVINAGYTADGGMAEE
CIVTADYSVKVPDGLESAAASSITCAGVTTYKAVKISGIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIALDVNDEQLKLAESMGADLIINSRSPDAAKLVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIQVVGSLVGTRQDLAEAFQFAAEG
KVVPKVASRPLEDINAIFKEMEQGQIRGRMVIDFRK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgctgtcgtcacaaaagatcatcaggttgatgtcactgaacgtaccctgcgc
ccgttgaaacatggtgaagcgcttctgaagatggaatgctgcggcgtttgccacaccgat
ctccatgtaaaaaatggcgattttggcgacaaaaccggcgtgattctgggccacgaaggt
atcgggattgtgaaagaagtcggcccgggtgtgacctcgctgaaacccggcgaccgcgca
agcgtcgcatggttcttccagggatgtgggcactgtgaatactgtaacagcggtaatgaa
accctgtgtcgcgaggtgattaatgccggttacacggcggatggtggtatggcggaagag
tgtatcgtcaccgccgactactccgttaaagtacctgacggtctggaatccgccgcggcc
agcagcatcacctgtgcgggcgtcaccacttataaagcggtaaaaatttccggcatcaaa
ccgggccagtggatcgctatctacggtctgggcgggctgggcaacctggcgctgcaatac
gccaaaaacgtctttaacgccaaagttattgcgcttgacgtcaatgatgaacagctgaaa
ctggctgaaagcatgggcgcagacttaatcatcaactcccgtagcccggatgccgcaaaa
ctggtgcaggaaaaaaccggtggtgcgcatgcagcagtggttaccgctgtcgccaaagcg
gctttcaactccgcggttgatgccgttcgtgccggtggccgcgtggtggctgttggtctg
ccgccggaagcgatgagcctggatatcccgcgcctggtgctggacggtattcaggttgtg
gggtcactggtcggtacgcgtcaggatctggccgaagccttccagtttgcagccgaaggg
aaagtggttcctaaagttgcctctcgcccgctggaagatatcaacgctatcttcaaagag
atggaacaaggccagatccgtggccgtatggtgattgatttccgtaaataa

DBGET integrated database retrieval system