KEGG   Enterobacteriaceae bacterium FGI 57: D782_2142Help
Entry
D782_2142         CDS       T02431                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00010  Glycolysis / Gluconeogenesis
ebf00071  Fatty acid degradation
ebf00350  Tyrosine metabolism
ebf00625  Chloroalkane and chloroalkene degradation
ebf00626  Naphthalene degradation
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01130  Biosynthesis of antibiotics
ebf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D782_2142
  Lipid metabolism
   00071 Fatty acid degradation
    D782_2142
  Amino acid metabolism
   00350 Tyrosine metabolism
    D782_2142
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    D782_2142
   00626 Naphthalene degradation
    D782_2142
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     D782_2142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGB78124
UniProt: L0M2G8
Position
complement(2227032..2228042)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHQVDVTERTLRPLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGIVKEVGPGVTSLKPGDRASVAWFFQGCGHCEYCNSGNETLCREVINAGYTADGGMAEE
CIVTADYSVKVPDGLESAAASSITCAGVTTYKAVKISGIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIALDVNDEQLKLAESMGADLIINSRSPDAAKLVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIQVVGSLVGTRQDLAEAFQFAAEG
KVVPKVASRPLEDINAIFKEMEQGQIRGRMVIDFRK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgctgtcgtcacaaaagatcatcaggttgatgtcactgaacgtaccctgcgc
ccgttgaaacatggtgaagcgcttctgaagatggaatgctgcggcgtttgccacaccgat
ctccatgtaaaaaatggcgattttggcgacaaaaccggcgtgattctgggccacgaaggt
atcgggattgtgaaagaagtcggcccgggtgtgacctcgctgaaacccggcgaccgcgca
agcgtcgcatggttcttccagggatgtgggcactgtgaatactgtaacagcggtaatgaa
accctgtgtcgcgaggtgattaatgccggttacacggcggatggtggtatggcggaagag
tgtatcgtcaccgccgactactccgttaaagtacctgacggtctggaatccgccgcggcc
agcagcatcacctgtgcgggcgtcaccacttataaagcggtaaaaatttccggcatcaaa
ccgggccagtggatcgctatctacggtctgggcgggctgggcaacctggcgctgcaatac
gccaaaaacgtctttaacgccaaagttattgcgcttgacgtcaatgatgaacagctgaaa
ctggctgaaagcatgggcgcagacttaatcatcaactcccgtagcccggatgccgcaaaa
ctggtgcaggaaaaaaccggtggtgcgcatgcagcagtggttaccgctgtcgccaaagcg
gctttcaactccgcggttgatgccgttcgtgccggtggccgcgtggtggctgttggtctg
ccgccggaagcgatgagcctggatatcccgcgcctggtgctggacggtattcaggttgtg
gggtcactggtcggtacgcgtcaggatctggccgaagccttccagtttgcagccgaaggg
aaagtggttcctaaagttgcctctcgcccgctggaagatatcaacgctatcttcaaagag
atggaacaaggccagatccgtggccgtatggtgattgatttccgtaaataa

DBGET integrated database retrieval system