KEGG   Enterobacteriaceae bacterium FGI 57: D782_2578Help
Entry
D782_2578         CDS       T02431                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    D782_2578
Enzymes [BR:ebf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     D782_2578
    3.5.1.-  
     D782_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2638611..2639252
Genome map
AA seq 213 aa AA seqDB search
MKARALLLVDLQNDFCAGGALAVAEGDSTVDIANTLITWCKARGEAVVASQDWHPANHGS
FASQHGVEPYTQGQLDGLPQTFWPDHCVQHSEGAELHPLLAQKSIDAVFHKGESVNIDSY
SAFFDNGHRQKTALDAWLRHHEISELIVLGLATDYCVKFTVLDALELGYRVNVITDGCRG
VNIQPQDSNQAFMEMAAAGATLYTLADWEETQG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacgagcactgttactggttgatctgcaaaatgatttctgcgcaggcggcgcg
cttgccgttgccgaaggggatagcacggttgatatcgccaatacgttgattacctggtgc
aaagcgcgcggcgaagccgttgtggcgagccaggactggcatccggccaatcacggtagc
tttgccagccaacacggcgttgagccctacacccagggccaacttgacgggctgccgcaa
accttctggcccgatcactgcgtgcaacatagcgaaggtgccgaattgcacccactgctg
gcgcagaaatcgattgatgcggtgtttcataaaggcgaaagcgtcaatattgacagctac
agcgcattcttcgataacggtcatcgccagaaaacggcgctggatgcgtggctgcgtcat
catgaaatcagcgagctgattgtgctcggtctggcaaccgactactgcgtgaagttcacc
gtgctggatgcgctggaactggggtaccgcgtgaacgtgataaccgacggctgtcgcggc
gtgaatatccagccgcaggacagcaatcaggcgtttatggagatggcggcagcgggcgca
acgctctatacgctggcggactgggaagagacgcaggggtaa

DBGET integrated database retrieval system