KEGG   Enterobacteriaceae bacterium FGI 57: D782_2821Help
Entry
D782_2821         CDS       T02431                                 

Definition
L-glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D782_2821
   00330 Arginine and proline metabolism
    D782_2821
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    D782_2821
Enzymes [BR:ebf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     D782_2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2881957..2882967)
Genome map
AA seq 336 aa AA seqDB search
MGFFSRTMHAHPDLINNRDLMNKLFSDVYSALKEETEGKVSTVYPALERVEPSLFGMCLY
GIDGEAYSVGDVDTDFSIMSISKPYIFALVCQAAGPQIARQTLGVNGTGMPFNSISAIEF
SESKLTNPMVNSGAIATSSFTPGKTKEEKWQYIYRGLCGFAGKELSFNEEIYESARETNY
RNRGIANLLYSYGRLGCDPETATDLYTRQCCLNINARDLAVMGATLADGGINPLTGDKVI
NNNICHYTLAVMITSGMYETSGEWLYETGLPAKSGIGGGIVAVSPGRCGLAAFSPRLDSA
GNSIKAQKAIRALSRHLGMNLLVSDPYQDLSATTKE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttttccaggacgatgcacgcccatccggacttaataaacaatcgtgattta
atgaataaactcttttcagatgtctattccgctttaaaggaggaaacagaaggtaaagtt
tcaacggtctatccagctcttgagcgggtggaaccgtcactatttgggatgtgtctatac
ggcattgatggcgaagcatattcggtgggcgatgttgacactgatttttccattatgagt
atctccaaaccctacattttcgccctggtgtgccaggcggcaggcccacaaattgctcgc
caaacgctgggcgtaaatggcaccggtatgccatttaactcgatctctgccatcgagttc
tctgagagcaaactcacaaatccaatggtgaattctggtgccattgccacctcaagtttc
acacccggtaaaaccaaagaagagaagtggcaatatatctatcgcggtctgtgcggtttc
gcgggtaaagagctctcttttaatgaggaaatctatgagtctgcccgtgagactaattac
cgtaatcgcggtattgccaatttactttatagctatgggcgactggggtgcgatccagaa
actgcaactgacctctatacgcggcaatgttgcctgaacatcaacgcgcgggatctcgcc
gtgatgggagcaacactggccgatggtggtatcaacccgctaacgggggacaaagtgata
aacaacaatatctgccattacaccctggcggtaatgatcacctctggtatgtatgaaacc
tccggagagtggttatacgagaccggcctgcccgctaaaagcggaataggaggagggatc
gtggccgtttcgccgggtcgatgcggtctggcggcgttctcgccaaggcttgatagcgcc
ggaaacagcattaaagcacagaaagccatccgcgcgctgtcgcgtcacctcggcatgaat
ctactggtttcagacccttatcaggatctcagcgcgacaacaaaggaatga

DBGET integrated database retrieval system