KEGG   Enterobacteriaceae bacterium FGI 57: D782_3022Help
Entry
D782_3022         CDS       T02431                                 

Definition
beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D782_3022
Enzymes [BR:ebf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     D782_3022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3104064..3105461)
Genome map
AA seq 465 aa AA seqDB search
MITTFPEKFLWGGALAANQVEGAWQEDGKGISTSDMLPEGIFGEPVKSREGISSIKDVAI
DFYHRYPEDISLFAEMGFTCLRVSIAWTRIFPMGDENEPNEAGLAWYDKLFDELRAHNIQ
PLVTLSHYEMPWGLVENYGGWGNRKVITFFERYARTVFTRYQHKVKLWLTFNEINMSLHA
PLTGVGLQKDCSKAEVYQAIHHQLVASGLAVKACHEIIPDAKIGNMLLGGLMYPLTCKPE
DVFATLQDNRQWQFFGDVQCRGRYPGYMQRYFRENDIALNITEEDNAALSHTVDFISFSY
YMTGCVTADSELVEKLKGNILDMVPNPHLESSEWGWQIDPIGLRTLLNVLWDRYQKPLFI
VENGLGAQDKPDANGEINDDYRISYLNDHLVQVQEAIQDGVDVMGYTSWGPIDIISASKA
EVTKRYGFIYVDLAQDGSGTLNRSRKKSFYWYQKVIATRGGALQR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgatcacaacatttccggaaaaatttttatggggcggtgcgctggccgctaatcaggtt
gaaggtgcatggcaggaagatggcaaaggtatttccacctctgacatgctgccggaaggc
attttcggcgagccggtgaaaagccgcgaaggtatcagcagcattaaagatgtcgccatc
gatttttatcatcgctacccggaagatatttccctgttcgcggaaatgggctttacctgt
ttgcgcgtgtcgattgcctggacgcgtattttcccgatgggcgatgaaaatgagccgaat
gaggcgggcctggcgtggtatgacaaactgttcgatgagctacgggcgcataatattcaa
ccgctggtcacgttgtcgcattatgaaatgccgtgggggctggtggaaaattatggcggt
tggggaaatcgtaaggttattacgttcttcgaacgttatgcccggacggtatttacccgt
tatcagcataaagtcaaactgtggctgacatttaatgagatcaatatgtcgctgcatgca
ccgttaaccggtgtcggcctgcaaaaagattgcagcaaggcggaagtctatcaggcgatt
catcatcaactggtcgccagtggcctggcggtgaaagcctgccacgaaattatccctgac
gccaaaatcggtaatatgctgctgggcggtttaatgtatccgcttacctgtaaacctgaa
gatgtctttgccacattacaggataatcgtcagtggcagttcttcggcgatgtgcaatgt
cgtggacgttatccggggtatatgcagcgttatttccgtgaaaatgacatcgcgctaaat
atcaccgaagaagataatgctgcgcttagtcatacggttgattttatctctttcagctat
tacatgaccggctgcgtcacggcagacagcgagctggttgaaaaactgaaagggaatatt
ctggatatggtacccaacccgcatctggagagttcggagtggggatggcaaattgatccc
atcggtctgcgtacgctgcttaatgtattgtgggatcgctatcagaagccgctatttatc
gtggaaaatgggttaggtgcgcaggataaaccggatgccaacggcgaaatcaacgacgat
taccgtattagttatctgaacgatcatctggtgcaggtccaggaagctattcaggatggt
gttgacgtcatgggatacacctcatgggggccgattgatattatcagcgcttctaaagcg
gaagtgactaaacgctacgggtttatctacgtcgatttagcgcaggacggctccggcacg
cttaaccgcagtcgtaagaaaagtttctactggtatcagaaagtcattgcgacgcgcggt
ggcgctttgcagcgataa

DBGET integrated database retrieval system