KEGG   Enterobacteriaceae bacterium FGI 57: D782_3078Help
Entry
D782_3078         CDS       T02431                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    D782_3078
   00500 Starch and sucrose metabolism
    D782_3078
Enzymes [BR:ebf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     D782_3078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3164763..3166046
Genome map
AA seq 427 aa AA seqDB search
MNTLSVSRLALALAFGVTLTACSSTPADQRPSEQAAPGTSSRPVLSADEAQNFVAARYFT
ALDPKGAAWSPSAISTPAQPDFVVGAAGQQGVTHTSIQAAVDAAIARHSSKRQYIAILPG
EYQGTVYVPAAPGSVTLYGTGEKPLDVKIGLAIDSEMAPAAWRHLVNPAGKYMPGKPSWY
MYDNCQSKRSATIGVMCSAVFWSQNNGLQLQNLTIENNLGDSVDAGTHQAVALRTDGDQV
QINKVNILGRQNTFFVTNSSVNNRLQNDRQTRTLVSNSYLEGDVDIVSGRGAVVFDNTDF
RVVNSRTQQEGYVFAPATQANIYYGFLAINSRFIASGDNVAQLGRSLDVDGNTNGQVVIR
DSVINEGFNMAKPWADAAISKRPFAGNTGAKDDKGNVQRDLNDRNFNRMWEYNNRGVGSK
VLAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacactttatcggtttcccgtctggcgctggcattggctttcggcgtgacactgact
gcttgcagctcaacccctgcggatcaacgcccgtctgaacaggccgcaccggggacgtca
tcccgtccggttttatccgcagatgaagcgcaaaacttcgttgccgcgcgttacttcact
gctctcgatcctaaaggcgcggcctggtcgccgtctgcaattagcaccccggcacaacct
gatttcgtggttggcgcagcgggccagcagggcgtaacgcacacctccatccaggccgcc
gtcgatgccgccattgcgcgtcacagcagcaagcgtcagtacattgcgattctgccgggt
gagtatcagggcaccgtctatgttcctgccgcaccgggcagcgtaacgctgtacggtacg
ggcgaaaaaccgctcgacgtaaaaattggcctggcgatcgactccgaaatggcccctgcc
gcctggcgtcatctggtcaacccggccggaaaatatatgccgggcaaaccgtcctggtat
atgtatgacaactgccagagcaaacgcagcgcgactattggcgtgatgtgttcagcggtc
ttctggtcgcagaacaacggtctgcaactgcagaacctgaccattgaaaacaacctcggc
gacagcgtcgatgccggtacgcatcaggcagtcgctctgcgtaccgatggcgatcaggta
caaatcaacaaggtgaacattctgggtcgccagaacaccttctttgtgaccaacagcagc
gtcaacaaccgcctgcaaaacgatcgtcagacccgtacgctggtaagcaacagctacctc
gaaggggatgtggacatcgtttctggccgtggcgcagtggtgtttgataataccgacttc
cgcgtggtgaactctcgcactcagcaggaaggctacgtcttcgcaccggcaacccaggca
aacatttactacggcttcctggctatcaatagccgctttatcgcttccggcgataacgtt
gcacagttgggccgctctctggacgtcgatggcaacaccaacggtcaggtcgtgattcgc
gacagcgtaattaacgaaggcttcaacatggcaaaaccgtgggccgacgcggcaatctct
aaacgtccattcgcaggtaacaccggcgcgaaagacgataaagggaatgtgcagcgtgac
ctgaacgaccgtaacttcaaccgcatgtgggaatacaacaaccgcggcgtgggaagtaaa
gtgctggcagagccgaaacagtaa

DBGET integrated database retrieval system