KEGG   Enterobacteriaceae bacterium FGI 57: D782_3129Help
Entry
D782_3129         CDS       T02431                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00020  Citrate cycle (TCA cycle)
ebf00640  Propanoate metabolism
ebf00660  C5-Branched dibasic acid metabolism
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01130  Biosynthesis of antibiotics
ebf01200  Carbon metabolism
Module
ebf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D782_3129
   00640 Propanoate metabolism
    D782_3129
   00660 C5-Branched dibasic acid metabolism
    D782_3129
Enzymes [BR:ebf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     D782_3129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AGB79073
UniProt: L0M5A1
Position
complement(3211443..3212609)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDAHGQPVNQILVEAATDIDKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLAGPMPYQGRELAFKLGLEGKQVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQADLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKGLTDAAEQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactttttgcccgctatggcttaccggctccg
gtgggttatgcctgtactactccgcgtgaagcagaagaagccgcttcaaaaatcggtgca
ggtccgtgggtagtaaaatgtcaggttcacgctggtggccgcggtaaagcgggcggtgtg
aaagtcgtgaagagcaaagaagagattcgcgcttttgctgagcactggctgggtaaacgt
ctggtgacctaccaaacggatgcccacggtcagccggttaaccagattctggttgaagca
gcgacggatattgataaagaactctatctgggcgcggttgtagatcgttcctctcgtcgc
gtggtcttcatggcctctaccgaaggcggcgtggaaatcgagaaagtagcggaagaaacc
ccgcacctgatccacaaagtcgcactggatccgctggcgggcccgatgccgtatcagggt
cgcgagctggcgttcaaactgggtctggaaggtaagcaggttcagcaattcaccaaaatc
tttatgggtctggcgaccatcttccttgagcgcgacctggcgctgatcgaaatcaacccg
ctggtcatcaccaaacagggcgaccttatctgcctcgacggcaaactgggcgctgacggt
aacgcactgttccgccaggctgacctgcgcgaaatgcgtgaccagtctcaggaagatccg
cgtgaagcacaggctgcacagtgggaactgaactacgttgcgctggacggtaacatcggt
tgcatggttaacggcgcgggcctggcaatgggcaccatggacatcgttaaactgcacggt
ggcgaaccggctaacttccttgacgttggcggcggcgcaaccaaagagcgcgtaaccgaa
gcgttcaaaatcatcctttccgatgacaaggtgaaagccgttctggttaacatcttcggc
ggtatcgttcgttgcgacctgatcgctgacggtattatcggcgcggtagaagaagttggc
gtaaacgtaccggttgtcgttcgtctggaaggtaacaacgccgaactcggcgcgaagaaa
ctggctgatagtggcctgaatattattgcagcgaaaggtctgacggatgcagcagagcaa
gttgttgcagcagtggaggggaaataa

DBGET integrated database retrieval system