KEGG   Enterobacteriaceae bacterium FGI 57: D782_3130Help
Entry
D782_3130         CDS       T02431                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D782_3130
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D782_3130
  Amino acid metabolism
   00310 Lysine degradation
    D782_3130
Enzymes [BR:ebf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     D782_3130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3212754..3213968)
Genome map
AA seq 404 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGTTVTSRQILGRLREGNSGGKETSAKSEAKESTPAQRQQASLEEQNNDALSPAIRR
LLGEHNLEASAIKGTGVGGRITREDVEKHLAKAPAKADAPAAAAAPVAPLAGRSEKRVPM
TRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKA
VVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDSLGMADIEKRIKE
LALKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGK
VEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggtccctgacctgcctgaatccgtagcagatgccaccgtc
gcaacctggcataaaaaaccgggcgacgcggttgttcgtgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcgtcggcagacggcattctggatgcagtt
ctggaagacgaaggcacaaccgtaacgtctcgtcagatcctgggtcgcctgcgtgaaggc
aacagcggtgggaaagaaaccagcgctaagtctgaagcgaaagagtctaccccggcacag
cgccagcaggcctctctggaagagcaaaacaacgatgcgctcagcccggccattcgccgt
ctgctgggggaacataacctcgaagccagcgccattaaaggcacaggtgtcggtggccgc
attacccgtgaagacgtagaaaaacatctggcgaaagcgccggctaaagcagatgccccg
gcagctgcagcagcgccagttgcaccgctggctggccgtagcgaaaaacgtgtcccgatg
actcgcctgcgtaagcgtgtggcagagcgtctgctggaagcgaaaaactccaccgccatg
ctgacaacgttcaacgaagtcaacatgaagccgattatggatctgcgtaagcagtacggc
gaagcgtttgagaaacgtcacggtatccgtctgggctttatgtccttctacgtgaaagca
gtggttgaagcgctgaaacgctacccggaagtgaacgcctctatcgacggcgatgatgtg
gtttaccacaactacttcgacgtgagcatggcggtgtctacgccgcgtggtctggtgacc
ccggtactgcgtgatgtcgattctctgggcatggctgacatcgaaaaacgcattaaagag
ctggcgctgaaagggcgtgatggcaaattgacagtagaagatcttaccggcggcaacttt
accattacaaatggtggtgttttcggttctctgatgtctacccctatcatcaacccgccg
cagagcgctatcctgggcatgcacgccattaaagatcgcccgatggccgtggatggcaag
gtagaaattctgccgatgatgtacctggctctctcttacgatcaccgtctgatcgatggc
cgtgagtccgttggtttcctggtggcgattaaagagctgctggaagatccgactcgtctg
ctgctggacgtgtag

DBGET integrated database retrieval system