KEGG   Enterobacteriaceae bacterium FGI 57: D782_3130Help
Entry
D782_3130         CDS       T02431                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00020  Citrate cycle (TCA cycle)
ebf00310  Lysine degradation
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01130  Biosynthesis of antibiotics
ebf01200  Carbon metabolism
Module
ebf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D782_3130
  Amino acid metabolism
   00310 Lysine degradation
    D782_3130
Enzymes [BR:ebf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     D782_3130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: AGB79074
UniProt: L0M580
Position
complement(3212754..3213968)
Genome map
AA seq 404 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGTTVTSRQILGRLREGNSGGKETSAKSEAKESTPAQRQQASLEEQNNDALSPAIRR
LLGEHNLEASAIKGTGVGGRITREDVEKHLAKAPAKADAPAAAAAPVAPLAGRSEKRVPM
TRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKA
VVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDSLGMADIEKRIKE
LALKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGK
VEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggtccctgacctgcctgaatccgtagcagatgccaccgtc
gcaacctggcataaaaaaccgggcgacgcggttgttcgtgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcgtcggcagacggcattctggatgcagtt
ctggaagacgaaggcacaaccgtaacgtctcgtcagatcctgggtcgcctgcgtgaaggc
aacagcggtgggaaagaaaccagcgctaagtctgaagcgaaagagtctaccccggcacag
cgccagcaggcctctctggaagagcaaaacaacgatgcgctcagcccggccattcgccgt
ctgctgggggaacataacctcgaagccagcgccattaaaggcacaggtgtcggtggccgc
attacccgtgaagacgtagaaaaacatctggcgaaagcgccggctaaagcagatgccccg
gcagctgcagcagcgccagttgcaccgctggctggccgtagcgaaaaacgtgtcccgatg
actcgcctgcgtaagcgtgtggcagagcgtctgctggaagcgaaaaactccaccgccatg
ctgacaacgttcaacgaagtcaacatgaagccgattatggatctgcgtaagcagtacggc
gaagcgtttgagaaacgtcacggtatccgtctgggctttatgtccttctacgtgaaagca
gtggttgaagcgctgaaacgctacccggaagtgaacgcctctatcgacggcgatgatgtg
gtttaccacaactacttcgacgtgagcatggcggtgtctacgccgcgtggtctggtgacc
ccggtactgcgtgatgtcgattctctgggcatggctgacatcgaaaaacgcattaaagag
ctggcgctgaaagggcgtgatggcaaattgacagtagaagatcttaccggcggcaacttt
accattacaaatggtggtgttttcggttctctgatgtctacccctatcatcaacccgccg
cagagcgctatcctgggcatgcacgccattaaagatcgcccgatggccgtggatggcaag
gtagaaattctgccgatgatgtacctggctctctcttacgatcaccgtctgatcgatggc
cgtgagtccgttggtttcctggtggcgattaaagagctgctggaagatccgactcgtctg
ctgctggacgtgtag

DBGET integrated database retrieval system