KEGG   Enterobacteriaceae bacterium FGI 57: D782_3134Help
Entry
D782_3134         CDS       T02431                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D782_3134
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D782_3134
   00650 Butanoate metabolism
    D782_3134
  Energy metabolism
   00190 Oxidative phosphorylation
    D782_3134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3219629..3219976)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGDLTWEVWSGFFSSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRMVLQLAIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctcagcattaggacgcaacggcgtacatgacttcatcctggtacgt
gccaccgccatcgtcctgactctgtacatcatctacatggttggctttttcgcgacgagc
ggcgacctcacctgggaagtctggagtggtttcttctcctctgcgttcaccaaagtgttc
accttgttggccctgttttctatcctgattcatgcctggattggcatgtggcaggtgctg
accgactacgttaaaccgctggcactgcgcatggtgctgcaactggcaatcgttgttgcg
ctggtggtttacgtcatttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system