KEGG   Enterobacteriaceae bacterium FGI 57: D782_3176Help
Entry
D782_3176         CDS       T02431                                 

Definition
asparagine synthase, glutamine-hydrolyzing
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D782_3176
Enzymes [BR:ebf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     D782_3176
Peptidases [BR:ebf01002]
 Cysteine Peptidases
  Family C44
   D782_3176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3267196..3268860
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDIKTDAGELRKKALELSRLMRHRGPDWSGIYACDKAILAHERLSIVDVNAGA
QPLYNEKKTHALAVNGEIYNHQALRAEYADRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHIGIIPLYMGYDEFGNFYVASEMKALTPVCRTIKEFPAGSY
LWSKDGEIRQYYQRDWFDYDAVKDNVTDKNELRQALEESVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDDERSEAWWPQLHSFAVGLEGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLQALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHVLRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAKQVTDQQLET
AHFRFPYNTPSSKEGYLYREIFEELFPVPSAAECVPGGPSVACSSAKAIEWDEAFKTMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgatttttggtgtactggatattaaaactgacgcgggcgagctgcgtaaaaaa
gcgcttgagctctcccgcctgatgcgtcaccgcggcccggactggtccggcatttatgcg
tgcgacaaagccattctggcgcacgaacgtctgtcgattgttgacgtcaatgccggtgcg
cagccgctgtataacgaaaagaaaacgcatgcgctggccgtgaacggtgaaatctacaac
catcaggcactgcgtgcggaatacgctgaccgctaccagttccagaccggttctgactgc
gaagtgatcctcgcgctgtatcaggaaaaaggtccggaattcctcgatgatttgcagggg
atgtttgccttcgccctctacgacagcgaaaaagacgcctacctgattggccgcgaccac
atcggcattatcccgctgtatatgggttacgacgaattcggtaacttctatgttgcttca
gaaatgaaagcgctgaccccggtttgccgcaccatcaaagagttcccggcaggcagctac
ctgtggagcaaagatggcgaaattcgtcagtattatcagcgtgactggttcgactatgac
gcagtaaaagacaacgttaccgataaaaacgaactgcgtcaggcgctggaagagtcggtg
aaaagccacctgatgtctgacgtgccttacggcgtactgctttccggtggcctggactcc
tccgtcatttccgccatcaccaaaaaattcgccgcacgtcgcgtagaagatgatgagcgt
tctgaagcctggtggccgcagctgcactccttcgccgttggtcttgaaggttcacctgac
ctgaaagccgcgcaggaagtggcaaaccacctcggcaccgtgcaccatgaaattcacttc
accgtgcaggaaggtctggatgcgattcgcgatgttatctatcacatcgaaacctatgat
gtgacgacgattcgcgcctccacgccgatgtatttgatgtcgcgtaaaatcaaagcgatg
ggcatcaaaatggtgctctctggcgaaggttctgatgaagtgtttggcggctacctttac
ttccataaagcgcctaacgccaaagagctgcacgaagagactgtacgtaaactgcaggca
ctgcacatgtacgactgcgcgcgtgccaacaaagcgatgtcggcatggggcgtggaagcg
cgcgtaccgttcctcgataaaaaattcctcgacgtggcgatgcgcatcaacccgcaggac
aaaatgtgcggcaacggcaaaatggaaaaacacgttctgcgtgaatgttttgaatcctac
ctgccggcaagcgtcgcatggcgccagaaagagcagttctctgatggtgtaggctacagc
tggattgacacactgaaagaagtcgcggcgaaacaggttaccgaccagcaactggaaacc
gcacacttccgcttcccgtacaacacgccgagctctaaagagggttatctgtaccgcgaa
atcttcgaagagttattcccggtgccaagcgcagcggaatgcgtgccgggcggcccgtca
gtcgcgtgttcttcggcgaaagcgattgagtgggatgaagcgttcaaaaccatggacgat
ccgtctggccgcgccgtaggcgttcaccagtcagcctacaaataa

DBGET integrated database retrieval system