KEGG   Enterobacteriaceae bacterium FGI 57: D782_3324Help
Entry
D782_3324         CDS       T02431                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    D782_3324
Enzymes [BR:ebf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     D782_3324
   3.1.2  Thioester hydrolases
    3.1.2.-  
     D782_3324
Lipid biosynthesis proteins [BR:ebf01004]
 Fatty acid synthase
  Component type
   D782_3324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3425144..3425737
Genome map
AA seq 197 aa AA seqDB search
MPVLFLILLSFRAVAADTLLILGDSLSAGYRMAANTAWPALLNSKWQPKTEVINASISGD
TSAQGLARLPALLKQHKPRWVLVELGGNDGLRGFQPQQTEQTLRTILQQIKAANAEPLLM
QIRLPANYGRRYNEAFSAIYPQLAQEFTIPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPF
IADWMATRLAPLVNHDS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgtcctgtttttgattctgttaagcttccgcgccgtcgccgcagacacgttgttg
atcctcggcgatagcctgagcgcgggatatcgtatggccgccaatacggcctggcctgcc
ctgctcaacagcaaatggcagccaaaaacagaggtgattaacgccagtatcagcggcgac
acctcggcacaggggctggcgcgcctgcctgcgttgttgaaacagcataaaccacgctgg
gtgctggttgagctgggcggcaatgatggcctgcgcggcttccagcctcagcaaaccgag
caaacgctacgcaccattctgcaacaaattaaagcggccaacgccgagccgttgttaatg
caaattcgcctgcccgcaaactacggacgccgctataatgaggcctttagcgcgatttat
ccgcagcttgcccaggaattcactatcccactgctgcccttctttatggaagaggtttat
ctcaaaccgcagtggatgcaggatgatggtattcaccccaatcgtgacgcccaaccgttt
atcgccgactggatggcgacacgcctggcaccactagttaatcacgactcctga

DBGET integrated database retrieval system