KEGG   Enterobacteriaceae bacterium FGI 57: D782_3351Help
Entry
D782_3351         CDS       T02431                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ebf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3452231..3452836)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQSLTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLETESLSEVILATNPTVEGEATANYIAELCAQHGVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaactcagcttatggaagcactgcgctgcctgccgggcgtt
ggcccgaagtccgcgcagcgtatggcgtttacgctgctgcagcgcgatcgcagcggcgga
atgcgtctggcgcagtcgctgacccgcgccatgtcggaaatcggccactgtgccgattgc
cgcaccttcaccgagcaggaagtctgtaacatctgttcgaacccgcgtcgccaggaaaac
ggccaaatctgcgtggtggagagtcctgcggacatctacgccattgagcagaccgggcag
ttttccggccgctacttcgtgctgatgggccacctgtcgccgctcgacggcatcgggccc
gatgatatcggtctcgaccgcctggagcagcgtctggaaacggaatcgctcagtgaagtt
atcctcgctaccaaccccacggtggaaggggaggcgaccgccaactacatcgccgagctg
tgcgctcagcacggtgtggaagccagccgcatcgcccacggcgtacccgttggcggcgaa
ctggagatggtcgatggcaccacgctttcgcactcgctcgccggtcgtcataagattcgt
ttttaa

DBGET integrated database retrieval system