KEGG   Enterobacteriaceae bacterium FGI 57: D782_3476Help
Entry
D782_3476         CDS       T02431                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ebf00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ebf00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ebf02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3580278..3581690)
Genome map
AA seq 470 aa AA seqDB search
MKYSALFIALLPLLATPNIHAETTTAPALDSRAAQGDITAPGGARRLSGDQSAALRASII
DKPAKNIILLIGDGMGDSEITAARNYALGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEQPHQTLLELAKSAGLATGNVSTAELQDATPAA
QISHVTSRKCYGPSVTTEKCPTNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLISDASELASITVANQDKPLLGLFSDGNMPVRWEGPKASYHGN
IDKPVVTCTPNPKRNDSVPTLAQMTDKAITLLSSNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALAFAQKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEESMEHTGTQVRIAAYGPHAANVVGLTDQTDLYYTMKSALGL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacagcgcactctttattgccttattacctctgctggcaaccccgaatattcac
gccgaaaccacgactgcccccgcgcttgatagccgtgcggcgcagggtgatatcaccgcg
cccggtggcgcgcgtcgcctgagcggcgaccagtcggcggcgctgcgcgcgtcgattatt
gataaaccggccaaaaacattattttgctgattggcgatggcatgggtgattccgaaatt
accgccgcgcgcaactacgcgctgggcgcgggcggcttctttaaaggcattgatgcgctg
ccattaacgggccagtacacccattacgcgctggataagaaaacgggcaaaccggactac
gtcaccgattccgccgcctccgccaccgcatggagcaccggcgtgaaaacctacaacggc
gcgctgggcgtggatatccatgagcagccgcatcaaacgctgcttgagctggcaaaatcg
gcgggccttgcaaccggcaacgtctctaccgcggaattgcaggacgcgactccggcggca
cagatttctcacgtgacgtcgcgtaaatgctacggtccgagcgtaaccaccgaaaaatgc
ccgactaacgcgctggaaaaaggcggcaaaggctccattaccgagcaactgctgaacgcg
cgcgcagacgtcaccttaggtggtggcgcgaaaacctttgctgagaccgcaaccgcaggc
gaatggcagggcaaaaccctgcgtgagcaggcacaggcgcgcggttatcagttgataagc
gatgccagcgagctggcgagcattaccgtggcgaatcaggataaaccgctgctggggctg
ttttctgacggcaacatgccggtgcgctgggaagggccaaaagcatcctatcacggcaac
attgataaaccggtcgtaacctgtacgccgaacccgaaacgtaatgacagcgtgccgacg
ctggcgcagatgaccgacaaggccattacgctgctgagcagcaacgaaaaaggcttcttc
ctgcaggtggaaggcgcgtctatcgacaagcaggatcacgcggcgaatccgtgcgggcaa
attggtgaaacggtcgatctggacgaggccgtccagaaagcgctggcgttcgcacagaaa
gacggtaacacgctggtgatcgtcaccgctgaccacgcccacgccagtcagattgttgcg
ccggatactaaagcgccaggcctgacccaggcgctgaacaccaaagatggcgcggtcatg
gtgatgagctacggtaactcggaagaggaatcgatggagcataccggcactcaggtgcgc
attgccgcgtacggcccacatgcggcgaacgtcgttggcctgaccgatcagaccgatctc
tactacaccatgaagtccgcgcttggtctgtaa

DBGET integrated database retrieval system