KEGG   Enterobacteriaceae bacterium FGI 57: D782_3698Help
Entry
D782_3698         CDS       T02431                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00900  Terpenoid backbone biosynthesis
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01130  Biosynthesis of antibiotics
Module
ebf_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D782_3698
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     D782_3698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AGB79608
UniProt: L0M6V9
Position
complement(3839149..3840345)
Genome map
AA seq 398 aa AA seqDB search
MKQITVLGSTGSIGCSTLDVVRHNAEHFSVAALVAGKNVDRMVEQCLEFSPRFAVMDDAH
SAEAVKIALREHGSRTEVMCGQQAACEVAALDDVDQVMAAIVGAAGLVPTLAAIHAGKTV
LLANKESLVTCGRLFLEAVKASGAQLLPVDSEHNAIFQSLPQTFQQDLGYADLGQHGVTS
ILLTGSGGPFRETPISELRAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAAQMEVVIHPQSVIHSMVRYKDGSVIAQLGEPDMRTPIANAMAWPGRAESGVKPLDFC
KLGALTFSEPDYDRYPCLKLAMDAFEQGQAATTALNAANEITVAAFLDSQIRFTDIAAAN
LAVLEAMSLAEPQSVDEVLVIDAQARDVARKQVTRFAS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaataaccgttcttggctcaacgggctcaattggctgtagcacgctggacgtt
gtgcgccataacgctgagcatttctccgttgccgcgctggtagccggtaaaaacgtcgat
cgcatggtcgagcagtgtctggagttttctccgcgtttcgcggtgatggatgacgcccat
agcgccgaagctgtgaaaatcgctctgcgtgaacacggtagccgcactgaagtgatgtgc
gggcaacaggcggcgtgtgaagtggccgcgctggacgacgttgatcaggtgatggccgcc
atcgttggcgcggcgggcctggtaccgacgcttgccgctattcatgccggcaaaacggtt
ttactggcgaacaaagagtcattggtgacctgcggacgcctgttccttgaagcggtgaaa
gccagcggcgcgcaacttttaccggtcgatagcgaacataacgccatctttcagagtttg
ccgcaaacttttcagcaagacctggggtacgctgatctcgggcagcatggcgtcacgtcc
attctgcttaccgggtctggtggaccgttccgtgagacgccaatcagtgaactgcgcgca
atgacgccggatcaggcttgccgtcatccgaactggtcgatggggcgtaaaatatccgtc
gactctgccaccatgatgaataaaggtctcgaatacattgaagcccgctggctgtttaac
gcctccgccgcgcaaatggaagtggtgattcatccgcagtcggtgatccactcgatggtg
cgctataaagacggcagcgtcattgcgcaactcggcgagccggatatgcgtacgcctatc
gccaatgcgatggcctggcccggacgtgcggaatcaggcgttaagccgctcgatttctgc
aaactgggcgcactgacgtttagcgaaccggattacgatcgttacccttgccttaagctg
gcgatggacgcgttcgagcaggggcaggcggcgacaaccgcactgaatgcggcgaacgaa
attaccgttgctgcattcctggactcgcagattcgctttaccgatatcgcggcggcgaac
ctggcggtgctcgaagccatgtcgcttgctgagccgcagtccgtcgatgaggtgctggtg
attgacgcgcaagcgcgtgatgtggcgcgaaaacaagtgacgcgtttcgcaagctga

DBGET integrated database retrieval system