KEGG   Enterobacteriaceae bacterium FGI 57: D782_3785Help
Entry
D782_3785         CDS       T02431                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    D782_3785
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D782_3785
Enzymes [BR:ebf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     D782_3785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3941265..3942752)
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPNAPERALREMTLDSRVAASGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEATDGEIREMHGVPVIYLSQLTERLSALAGRFYHEPSDRLRLVGVTGTNGK
TTTTQLLAQWGQLLGETSAVMGTVGNGLLGKVIPTENTTGSAVDVQHVLSGLADQGATLA
AMEVSSHGLVQHRVAALKFVASVFTNLSRDHLDYHGDMEHYEAAKWLLYSTHHCGQAIVN
ADDEVGRRWLARLPDAVAVSMEDHINPNCHGRWLKATEVNYHDSGATIRFSSTWGDGEIE
SRLMGAFNVSNLLLALATLLALGYPLADLLKTASSLQPVCGRMEVFSAPGKPTVVVDYAH
TPDALEKALEAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEQFADIAVVTDDNPRTEE
PRAIINDILAGMLDAGHAKVVEGRAQAVTNAIMQAKPDDLVLLAGKGHEDYQIVGTQRLD
YSDRVTAARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttctcgctccgtgggtgccaaatgcgccggagcga
gcactgcgagagatgacactcgacagccgtgtggctgcatcgggcgatctcttcgtagcg
gtggttggtcatcaggcggacgggcgtcgttatatcccgcaggcaattgcgcaaggtgta
gctgccattatagccgaggcaaaagatgaagcgaccgatggcgaaatccgtgaaatgcac
ggcgtcccggtgatttacctcagccagttgacggagcgcttatcggcactggccgggcgc
ttttaccatgaaccgtcagaccgtttgcgcctcgtgggcgtgaccggcaccaacggtaaa
accaccaccacccaactgctcgcacagtgggggcaactgctgggcgaaaccagcgcggtg
atgggcacggtcggtaacggcctgctgggtaaagtgatcccaacggaaaataccaccggt
tcagcggttgatgttcagcacgtgctgtccggcctggcagaccagggcgcgacgctggcg
gcaatggaagtctcttctcacggactggtacagcaccgcgtggcggcactgaaatttgtg
gcttctgtgtttaccaacctgagccgcgatcaccttgattatcatggtgatatggaacat
tacgaagcagcgaaatggctgctttactccacgcaccactgtggtcaggcgattgttaac
gccgatgacgaagtgggccgccgctggctggcaagattgccggacgcggttgcagtgtcg
atggaagatcacatcaatccgaactgccacgggcgctggttaaaagcgaccgaggtgaac
tatcacgacagcggcgcaaccatccgtttcagctcgacctggggcgacggcgaaattgaa
agccgcctgatgggcgcgttcaacgtcagcaacctgctgctggcactggccacgctgctg
gcgctggggtatccgctggcggatctgctgaaaaccgcttccagcctgcaaccggtttgc
ggccgtatggaagtgttcagcgcgccgggtaaaccgacggtggttgtcgattacgcgcac
acgccggatgcgctggaaaaagcgctcgaagcggcgcgtctgcactgcgcgggcaaactg
tggtgcgtctttggttgcggcggtgaccgtgataaaggtaaacgtccgctgatgggcgcg
attgccgagcagtttgccgatatcgccgtggtcaccgatgacaacccgcgtaccgaagag
ccgcgcgccatcatcaacgacattctggcgggcatgcttgacgccggccacgccaaagtg
gtggaaggacgtgcgcaagcggtcactaacgccatcatgcaggcgaagcctgatgacctg
gtgctgctggccggtaaaggtcatgaagattatcaaattgtcggcactcaacgtctcgac
tattccgaccgtgtaaccgcagcgcgtctgctgggagtaatcgcatga

DBGET integrated database retrieval system