KEGG   Enterobacteriaceae bacterium FGI 57: D782_3820Help
Entry
D782_3820         CDS       T02431                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ebf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ebf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3985021..3985638)
Genome map
AA seq 205 aa AA seqDB search
MLAVHCTPVGSPAILKIFVFFTLRPVDERLCFPYSGDNFFVSGKHSMISLIAALAVDRVI
GMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNIVISSQPGTDDRVQW
VKSVDEAIAACGDVEEIMVIGGGRVYEQFLPKAHKLYLTHIDAEVEGDTHFPDYDPDQWE
SVFSEFHDADEQNSHSYCFEILERR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggtccactgcactcccgtgggctcgccagcaattctgaaaattttcgtattc
tttactctgcgcccagtcgacgaaagattatgctttccgtatagtggcgacaattttttt
gtatccgggaaacactcaatgatcagtctgattgctgcgctagcggtagatcgcgtcatc
ggcatggaaaacgccatgccctggaatctccccgccgatctggcgtggtttaaacgcaac
acgcttaacaaacctgtcgtaatgggtcgtttgacctgggaatcgatcggtcgcccgctg
ccgggccgtaaaaacatcgttatcagcagccagccaggcaccgacgatcgcgtccagtgg
gtgaagtcggtggatgaagccattgccgcctgcggcgatgtggaagagattatggtgatt
ggcggcggccgtgtttacgagcagttcctgccgaaagcgcacaagctgtacctgacgcac
attgatgcggaagtggaaggcgacacgcacttcccggattacgatccggaccagtgggaa
tctgtgttcagcgaattccacgacgcggacgagcagaattcgcacagttactgttttgag
attttagagcgtcgatag

DBGET integrated database retrieval system