KEGG   Enterobacteriaceae bacterium FGI 57: D782_3820Help
Entry
D782_3820         CDS       T02431                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D782_3820
   00670 One carbon pool by folate
    D782_3820
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     D782_3820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3985021..3985638)
Genome map
AA seq 205 aa AA seqDB search
MLAVHCTPVGSPAILKIFVFFTLRPVDERLCFPYSGDNFFVSGKHSMISLIAALAVDRVI
GMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNIVISSQPGTDDRVQW
VKSVDEAIAACGDVEEIMVIGGGRVYEQFLPKAHKLYLTHIDAEVEGDTHFPDYDPDQWE
SVFSEFHDADEQNSHSYCFEILERR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggtccactgcactcccgtgggctcgccagcaattctgaaaattttcgtattc
tttactctgcgcccagtcgacgaaagattatgctttccgtatagtggcgacaattttttt
gtatccgggaaacactcaatgatcagtctgattgctgcgctagcggtagatcgcgtcatc
ggcatggaaaacgccatgccctggaatctccccgccgatctggcgtggtttaaacgcaac
acgcttaacaaacctgtcgtaatgggtcgtttgacctgggaatcgatcggtcgcccgctg
ccgggccgtaaaaacatcgttatcagcagccagccaggcaccgacgatcgcgtccagtgg
gtgaagtcggtggatgaagccattgccgcctgcggcgatgtggaagagattatggtgatt
ggcggcggccgtgtttacgagcagttcctgccgaaagcgcacaagctgtacctgacgcac
attgatgcggaagtggaaggcgacacgcacttcccggattacgatccggaccagtgggaa
tctgtgttcagcgaattccacgacgcggacgagcagaattcgcacagttactgttttgag
attttagagcgtcgatag

DBGET integrated database retrieval system