KEGG   Enterobacteriaceae bacterium FGI 57: D782_3894Help
Entry
D782_3894         CDS       T02431                                 

Definition
DNA polymerase III, psi subunit
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    D782_3894
   00240 Pyrimidine metabolism
    D782_3894
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    D782_3894
   03430 Mismatch repair
    D782_3894
   03440 Homologous recombination
    D782_3894
Enzymes [BR:ebf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     D782_3894
DNA replication proteins [BR:ebf03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     D782_3894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4067528..4067941)
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPTALQGEIAISLPEHIQLVMVADDLPLLTEPLISDVLRA
LQLTPDRVLQLTPEKVAMLPQGKRCNCWRLGNDEPVSLEGAQVSTPAFNELKASAPARAA
LWQQICAHEHDFYPQHD
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccggcgagactggcaattacaacagttgggcatcacccagtggtctctcagg
cgcccgacggcgttgcagggggagattgcgatttcgctaccggaacatatccaactggtg
atggtcgccgatgatctgccgttgctgacggagccgcttattagcgatgtactgcgcgcg
ttgcagcttacgccagaccgcgtcctgcaacttacgcctgaaaaagtggcgatgctgccg
caggggaaacgctgcaactgctggcgtcttggcaacgatgagcccgtatcgctggaaggg
gctcaggtttcaacgcctgcctttaatgaattaaaagccagcgcgccagcacgcgccgcg
ctttggcaacaaatttgcgcacatgaacacgatttctaccctcagcacgactga

DBGET integrated database retrieval system