KEGG   Enterobacteriaceae bacterium FGI 57: D782_4004Help
Entry
D782_4004         CDS       T02431                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    D782_4004
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D782_4004
Enzymes [BR:ebf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     D782_4004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4180729..4181664
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSRDDLELVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSNNTSLGKKGETLADTISVISTYVDAIVMRHPQEGASRLATEFS
GGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLENLNVAMVGDLKYGRTVHSLTQALAKF
NGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSAIEEVMAEVDILYMTRVQKERLDPSE
YANVKAQFVLRAADLEGARDNMKVLHPLPRIDEITTDVDKTPHAWYFQQAGNGIFARQAL
LALVLTRDLDL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgctgtatcaaaaacatatcatttccatcaacgacctcagtcgcgacgat
ctggaactggtactggctaccgctgcaaagctgaaagcaaacccgcaaccggaactgctg
aagcacaaagtgattgccagctgtttcttcgaggcgtcaacgcgtacccgcctgtcgttt
gaaacctcaatgcatcgcctgggcgcgagcgtggttggtttctccgacagcaacaacacc
tcgctgggtaaaaagggcgaaacgctggcggataccatttcggtgattagcacctacgtc
gacgccatcgtgatgcgtcatccgcaggaaggtgcatcgcgtctggcgaccgagttctcc
ggcggcattccggtgttaaacgccggtgacggcgctaaccagcatccaacgcaaacgctg
ctcgacctctttaccattcaggaaacgcagggccgcctggaaaatctcaacgtggcgatg
gtcggcgacctgaaatatggccgtaccgttcactccctgacccaggcgctggcgaaattt
aacggcaaccgcttctactttatcgccccggacgcgctggcgatgccacagtacattctg
gatatgctcgatgagaaaggcattgcctggagcctgcacagcgccattgaagaagtgatg
gcggaagtggatatcctttatatgacgcgcgtgcagaaagagcgtctggacccgtcagaa
tatgccaacgtgaaggcgcagttcgtgctgcgcgccgccgacctggaaggcgcgcgcgac
aacatgaaagtgctgcacccactgccgcgtattgacgaaatcaccacggatgtcgataaa
acgccgcacgcctggtacttccagcaggctggcaacggtatcttcgctcgccaggcgtta
ctggcactggttctgactcgcgacctggatctgtaa

DBGET integrated database retrieval system