KEGG   Enterobacteriaceae bacterium FGI 57: D782_4258Help
Entry
D782_4258         CDS       T02431                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D782_4258
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    D782_4258
Enzymes [BR:ebf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     D782_4258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4455947..4457251)
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPAV
VDRINNTFRRADQIQWASGIEPNDPRYTDYFLPIVADAEAGFGGVLNAYELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDADAADL
ITSDCDAYDSEFITGERTSEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDLDLARR
FAEAVHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLARSYAQGEGMKHYVEKVQQPEFEAGKDGYTFVSHQQEVGTGYFDNVTTIIQGGAS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacacaacaaattgaagaattacagaaagagtggactcaaccgcgctgg
gaaggcattcgtcgcccctacagcgccgaggaagtggtgaaattacgcggctcggttaac
ccggagtgcacgctggcgcaactgggtgcggcgaagatgtggcgactgctgcacggtgag
tcgaagaaaggctacgttaacagcctcggcgcgttgaccggcggccaggcgttgcagcag
gcgaaagcgggtattgaagctatctatctttccggctggcaggtcgcggctgacgccaac
ctggcatcaagcatgtatccggatcaatcgctttatccggcgaactcggtgccggcggtg
gtggatcggatcaacaacaccttccgtcgcgcggatcagatccagtgggcatccggtatc
gaaccaaacgatccgcgttataccgattatttcctgccgatcgttgccgatgcggaagcc
ggtttcggcggcgtgctgaatgcctatgaactgatgaaatcgatgattgaggccggtgca
gcggccgttcacttcgaagatcagctcgcgtcggtgaagaagtgcggtcatatgggcggg
aaagtgctggttccgacgcaggaagccattcagaaactggttgcagcgcgcctggcggcc
gatgtgatgggcgtgccgacgctggtgattgcacgtacggatgcggatgcggcggatctg
atcacctctgattgcgatgcttacgatagcgaattcatcaccggcgagcgcaccagtgaa
ggcttcttccgtacccgtgcgggtatcgagcaggcgattagccgtggcctggcatatgcg
ccgtatgcagacctggtgtggtgtgaaacctcaacgccggacctcgacctcgcgcgccgt
tttgccgaggcggtccacgctaaatatccgggcaagctgctggcctacaactgctcgccg
tcgttcaactggcagaaaaatctggacgataaaaccatcgcaagcttccagcaacaattg
tcggatatgggctacaaataccagttcatcaccctggcgggcattcacagcatgtggttc
aacatgttcgacctggcgcgctcttacgcgcagggtgaaggcatgaagcattatgttgaa
aaagtgcagcagcctgaatttgaagcgggcaaagacggttacaccttcgtttctcatcag
caggaagtggggacgggctacttcgataacgtgacgaccattattcagggcggtgcttcc
tcggtaaccgcgttgaccggctcaacggaagagtcacagttctga

DBGET integrated database retrieval system