KEGG   Enterobacteriaceae bacterium FGI 57: D782_4259Help
Entry
D782_4259         CDS       T02431                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00620  Pyruvate metabolism
ebf00630  Glyoxylate and dicarboxylate metabolism
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01200  Carbon metabolism
Module
ebf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    D782_4259
   00630 Glyoxylate and dicarboxylate metabolism
    D782_4259
Enzymes [BR:ebf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     D782_4259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AGB80146
UniProt: L0MBS8
Position
complement(4457283..4458884)
Genome map
AA seq 533 aa AA seqDB search
MTQQATTADELAFTEPFTGQEQQILTAEAVEFLSELVTRFTPKRNKLLAARIQQQQDIDD
GKLPDFISETASIRNSDWKIRGIPADLQDRRVEITGPVERKMVINALNAKVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPALLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKALLEKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFDLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNTQVLNKVKADKSLEANNG
HDGTWVAHPGLADTAMAVFNDVLGEHKNQLFVTRSDDAPITAEQLLAPCDGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKAVTKALFR
QMLDEELLVIQEELGEHRFSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaggcaacaacggcggatgaactggcgtttaccgaaccttttaccgggcag
gagcagcagatcttaacggctgaagccgtcgaatttctcagtgaactggtgacgcgcttt
acgccgaagcgcaataaactgctggctgcgcgcattcagcaacagcaggatatcgatgac
ggaaagttgcctgattttatttcggaaactgcttccattcgtaatagtgactggaaaatc
cgtggtatcccggcagacttacaggatcgccgcgtagagatcaccggcccggttgaacgc
aaaatggtgattaacgccctgaacgccaaagtaaaagtctttatggctgatttcgaagat
tcgctggcgccggactggaacaaagtgattgatgggcaaatcaacctgcgcgatgccgtg
aacggcaccatcagctacaccaatgaagccgggaaaatctaccagttgaaacccaatccc
gcgctgctgatttgccgcgtgcgcggcctgcatttaccggagaaacacgttacctggcgc
ggtgaagccattccgggcagcttgtttgatttcgcgctctacttcttccacaactacaaa
gcgttgctggagaaaggcagcggcccttacttctacctgccgaaaacccaggcctggcag
gaagcggcctggtggagtgaagtctttagctatgcggaagatcgctttgacctgccgcgc
ggtaccatcaaagccactctgttgattgaaacgctgcccgccgtcttccagatggatgaa
atcctgcacgcgctgcgcgatcacattgtcggcctgaactgtggccgctgggattacatc
ttcagctacattaaaaccctgaaaaaccacccggaccgcgtgttgcctgaccgccaggtg
gtgacgatggacaaaccgtttctcagcgcatattcacgcctgctgattaaaacctgccac
aaacgcggcgcgttcgcgatgggcggcatggcggcgtttatcccgagcaaagacgccgag
cgaaatacgcaggtgctcaacaaagtcaaagcggataaatcgctggaagccaataacggc
catgacggcacatgggtggcgcatccggggctggcggacaccgcgatggcggtcttcaac
gatgtgctcggcgagcataaaaatcagttattcgtgacccgcagcgacgatgcgccgatc
accgctgaacaactgctggccccctgtgacggtgaacgtaccgaagagggcatgcgcgcc
aatattcgcgtcgcggtgcagtacatcgaagcgtggatctccggcaacggctgcgtccct
atctacggcctgatggaagatgcggcgacggcggaaatctcgcgtacttccatctggcag
tggatccatcatgagaaaaccctgagcaacggcaaagccgtcaccaaagcgctgttccgc
cagatgctagacgaagagttgttggtgattcaggaggagctgggcgagcaccgcttcagc
agcgggcgcttcgacgacgccgcgcgtctgatggaacagatcaccacttccgacgacctt
atcgacttcctgactctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system