KEGG   Enterobacteriaceae bacterium FGI 57: D782_4309Help
Entry
D782_4309         CDS       T02431                                 

Definition
fatty oxidation complex, alpha subunit FadB
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D782_4309
   01212 Fatty acid metabolism
    D782_4309
  Carbohydrate metabolism
   00640 Propanoate metabolism
    D782_4309
   00650 Butanoate metabolism
    D782_4309
  Lipid metabolism
   00071 Fatty acid degradation
    D782_4309
   01040 Biosynthesis of unsaturated fatty acids
    D782_4309
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D782_4309
   00310 Lysine degradation
    D782_4309
   00380 Tryptophan metabolism
    D782_4309
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D782_4309
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    D782_4309
   00281 Geraniol degradation
    D782_4309
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    D782_4309
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     D782_4309
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     D782_4309
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     D782_4309
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     D782_4309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4511424..4513613
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLNWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEKQKELKGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSEWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRLLGADSALETIAAGKDVGAEQALK
IGLVDGVVKHEKLIDGALAVLRQAINGDLDWRSKRRPKLEPLKLSKVEATMSFTIAKGMV
MQTAGKHYPAPITAVKTIEAAARLGRDEALKLENQSFVPLAHTNEARALVGIFLNDQYVK
GLAKKLAKTTDAPKHAAVLGAGIMGGGIAYQSAWKGVPVIMKDINEKSLTLGMTEASKLL
NKQLERGKIDGLKLAGVISTIQPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
DAVLASNTSTIPIGELADTLERPENFCGMHFFNPVHRMPLVEIIRGKKTSEQTIAKVVSW
ASQMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKP
KKEEDAQTDSLLADVSQPKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYDVPEGLRNKARHNEPYYPAVEPA
RPVGTLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgataccctgtacctcaactggctggaagatggcattgccgaactg
gtgttcgacgcccccggctcggtgaataaattagatacggcgaccgtagccagcctcggt
cacgcgctcgatgtcctcgaaaaacaaaaagagctgaaagggctgctgctgcgctctgaa
aaagcggcgtttatcgtcggcgcagacattaccgaattcctctcgctgttcctggtgcca
gaagaacagctcagcgaatggctgcatttcgccaacagcgtcttcaaccgtctggaagat
ttaccggttccgaccatcgccgccgttaacggctacgcgctgggcggtggctgcgaatgc
gtactggcgaccgattaccgtttagccacgccagacctgcgcataggcctgccggaaacc
aaactggggatcatgcccggttttggcggttccgtgcgtatgccacgcctgttgggcgcg
gacagcgcgctggaaactatcgctgccgggaaagatgttggtgcggagcaggcgctgaaa
atcggcctggtggatggcgttgttaaacacgagaaactgatcgacggcgcgctggccgta
ttgcgccaggcgataaatggcgatctcgactggcgctcgaagcgtcgtccgaaactggaa
ccgctgaagctcagcaaagtggaagccaccatgagcttcactatcgccaaaggcatggta
atgcaaaccgcaggcaaacattaccctgcccccattaccgccgtgaaaaccattgaagcc
gctgcacgtctggggcgcgatgaagccttgaagctggaaaaccaaagctttgtcccgctg
gcgcacaccaacgaagcgcgcgcgctggttggcatcttcctgaacgatcaatacgtgaaa
ggtctggcgaaaaaactcgccaaaaccaccgatgcgccgaaacacgccgccgttctgggc
gcgggcattatgggcggcggtatcgcgtatcaatcggcctggaaaggcgtgccggtgatc
atgaaagatatcaacgagaaatcgctgacgcttggcatgacagaggccagcaaactgctc
aataagcagctggagcgcggcaaaattgatggtctgaaactggcaggcgtcatttccacc
atccagcccacgctggattacgccgggttcgaccgtgtcgacgtggtcgtggaagcggtt
gttgaaaatccgaaagtgaaaaaagcggtgctggcggaaaccgagcaaaaagtacgcccg
gatgctgtgctggcctccaacacttcaaccattccgatcggcgaactggccgacacgctg
gagcgtccggaaaacttctgcggcatgcacttcttcaacccggtgcaccgcatgccgctg
gttgagatcattcgcggcaaaaagaccagtgagcaaaccatcgccaaagtggtttcctgg
gccagccagatgggcaaaacgccgatcgtggtcaacgactgccccggctttttcgttaac
cgcgtgctgttcccctacttcgccggtttcagccagctgctgcgcgacggcgcggatttc
cgcaaagtcgacaaagtaatggagaaacagtttggctggccgatgggcccggcttatcta
ctggacgtggtcggtatcgacaccgcacatcacgcacaagcagtgatggcggcaggtttc
ccgcagcgcatgcagaaagattatcgcgacgcaatcgacgccctgtttgatgccagccgc
ttcgggcagaaaaatggccttggcttctggcgctataaagaagacagcaaaggcaaaccg
aaaaaagaagaagacgcacaaaccgacagcctgctggccgacgtttcccagccgaagcgt
gacttcagcgacgaagagatcatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgctgcctggaagagggcatcattgccagcccggcagaagcagacatggcgctggtctac
ggcctgggcttccctccgttccacggcggtgcattccgctggctggatacgctgggtagc
gcgaaatatctcgatatggcgcagcagtatcagcacctcggtccgttgtatgacgtgccg
gaaggtctgcgcaataaagcgcgtcataacgaaccgtattatcccgcagtggagcccgcc
cgtccggttggcacgctgaaaacggcttaa

DBGET integrated database retrieval system