KEGG   Erwinia billingiae: EbC_01110Help
Entry
EbC_01110         CDS       T01270                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ebi  Erwinia billingiae
Brite
Enzymes [BR:ebi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     EbC_01110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
125376..125921
Genome map
AA seq 181 aa AA seqDB search
MSIRKKAVVCFVTVIIGIVGVEYSGQVRTSPQGLELIGDAEGCRRDPYICPADKLTAGIG
STTDIRAGHLYTDEEITAMWVEDIRRAERCIDRNFNGSLLNQGQFDAMTSAAFNMGCLNL
MWFTDRQGVKQRTTIWRHAQARRWADMCNRLPDFVNAAGRKLPGLVKRREAERLICLAPE
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcgaaaaaaggcggtggtgtgtttcgttacggtgattatcggcattgtcggg
gttgagtattccgggcaggtaagaaccagcccgcaggggctggagttgattggtgatgct
gagggatgccgtcgtgatccttacatctgccccgctgacaaactcacggcggggattggt
tcaaccacggatatccgggcgggccacctctacaccgatgaagagattaccgcgatgtgg
gttgaggatattcgccgggctgagcgttgcattgaccgcaattttaacggcagcctgctc
aatcagggccagtttgatgcgatgacctcagccgcgttcaatatgggttgcctcaatctg
atgtggttcaccgaccgtcagggcgttaagcagcgcaccactatctggcgtcacgcgcag
gccaggcgctgggcggatatgtgcaacaggctgccggactttgtgaacgccgcaggccgc
aagctaccaggactggttaaacgccgtgaagctgagcggctgatctgcctggcaccggag
gagtga

DBGET integrated database retrieval system