KEGG   Erwinia billingiae: EbC_01440Help
Entry
EbC_01440         CDS       T01270                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ebi  Erwinia billingiae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EbC_01440 (tpiA)
   01230 Biosynthesis of amino acids
    EbC_01440 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EbC_01440 (tpiA)
   00051 Fructose and mannose metabolism
    EbC_01440 (tpiA)
   00562 Inositol phosphate metabolism
    EbC_01440 (tpiA)
Enzymes [BR:ebi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EbC_01440 (tpiA)
Exosome [BR:ebi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EbC_01440 (tpiA)
  Exosomal proteins of bladder cancer cells
   EbC_01440 (tpiA)
  Exosomal proteins of melanoma cells
   EbC_01440 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(154780..155547)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKHMVNELIAGLRTELSNVDGCGVAIAPPVMYLDLAKHAISGSHIA
LGAQNVGVNLSGAFTGEISADMLKDVGAKYIIIGHSERRTYHKESDEFVAEQFAVLKAAG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLNTQGADAFNGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRGHIAKKDEAVAAQVIIQYGGSVNDKNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAAAAKNA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccgttagtaatgggtaactggaaactgaacggcagcaagcatatggtcaac
gaactgattgccggcctgcgtacagagctgagcaatgttgacggctgcggcgtagccatt
gcccctccggtgatgtatctggatctggcgaaacacgctatttctggcagccatatcgcc
cttggcgcgcagaatgtgggtgtgaacctgtctggtgcgtttaccggtgaaatttctgcc
gacatgctgaaagacgttggcgcgaaatacatcattatcggccactctgagcgtcgtact
taccacaaagagagcgacgagttcgtggctgagcagtttgccgtgctgaaagcagccggt
ctgatccctgtgctgtgcatcggtgaaaccgaagcagaaaacgaagcgggtaaaaccgaa
gaagtctgcgcacgtcagatcgacgcggtgctgaacacccagggcgcggacgcgttcaac
ggtgtggttattgcttacgagccagtatgggcgatcggtaccggtaaatcggcgactcca
gctcaggcccaggcggttcacaaattcattcgtggccatattgccaaaaaagatgaagcc
gttgccgctcaggttatcattcagtacggcggttctgttaacgacaagaacgccgctgaa
ctgtttgctcagccggacatcgacggtgcgctggttggcggcgcatcactgaaagcagat
gctttcgcggtgatcgttaaagcagctgcagcagcgaaaaacgcctga

DBGET integrated database retrieval system