KEGG   Erwinia billingiae: EbC_01440Help
Entry
EbC_01440         CDS       T01270                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ebi  Erwinia billingiae
Pathway
ebi00010  Glycolysis / Gluconeogenesis
ebi00051  Fructose and mannose metabolism
ebi00562  Inositol phosphate metabolism
ebi01100  Metabolic pathways
ebi01110  Biosynthesis of secondary metabolites
ebi01120  Microbial metabolism in diverse environments
ebi01130  Biosynthesis of antibiotics
ebi01200  Carbon metabolism
ebi01230  Biosynthesis of amino acids
Module
ebi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ebi_M00002  Glycolysis, core module involving three-carbon compounds
ebi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EbC_01440 (tpiA)
   00051 Fructose and mannose metabolism
    EbC_01440 (tpiA)
   00562 Inositol phosphate metabolism
    EbC_01440 (tpiA)
Enzymes [BR:ebi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EbC_01440 (tpiA)
Exosome [BR:ebi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EbC_01440 (tpiA)
  Exosomal proteins of bladder cancer cells
   EbC_01440 (tpiA)
  Exosomal proteins of melanoma cells
   EbC_01440 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAX57675
UniProt: D8MKL9
Position
complement(154780..155547)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKHMVNELIAGLRTELSNVDGCGVAIAPPVMYLDLAKHAISGSHIA
LGAQNVGVNLSGAFTGEISADMLKDVGAKYIIIGHSERRTYHKESDEFVAEQFAVLKAAG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLNTQGADAFNGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRGHIAKKDEAVAAQVIIQYGGSVNDKNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAAAAKNA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccgttagtaatgggtaactggaaactgaacggcagcaagcatatggtcaac
gaactgattgccggcctgcgtacagagctgagcaatgttgacggctgcggcgtagccatt
gcccctccggtgatgtatctggatctggcgaaacacgctatttctggcagccatatcgcc
cttggcgcgcagaatgtgggtgtgaacctgtctggtgcgtttaccggtgaaatttctgcc
gacatgctgaaagacgttggcgcgaaatacatcattatcggccactctgagcgtcgtact
taccacaaagagagcgacgagttcgtggctgagcagtttgccgtgctgaaagcagccggt
ctgatccctgtgctgtgcatcggtgaaaccgaagcagaaaacgaagcgggtaaaaccgaa
gaagtctgcgcacgtcagatcgacgcggtgctgaacacccagggcgcggacgcgttcaac
ggtgtggttattgcttacgagccagtatgggcgatcggtaccggtaaatcggcgactcca
gctcaggcccaggcggttcacaaattcattcgtggccatattgccaaaaaagatgaagcc
gttgccgctcaggttatcattcagtacggcggttctgttaacgacaagaacgccgctgaa
ctgtttgctcagccggacatcgacggtgcgctggttggcggcgcatcactgaaagcagat
gctttcgcggtgatcgttaaagcagctgcagcagcgaaaaacgcctga

DBGET integrated database retrieval system