KEGG   Erwinia billingiae: EbC_02230Help
Entry
EbC_02230         CDS       T01270                                 

Gene name
pldB
Definition
Lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ebi  Erwinia billingiae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EbC_02230 (pldB)
Enzymes [BR:ebi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     EbC_02230 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
254438..255430
Genome map
AA seq 330 aa AA seqDB search
MTGRKNGWPTREKAFAAFATGPLLDFWKRREEGEFTGVEDVAIRYVRFSAEKHDNVILLC
PGRIESYVKYPELAYDLFHCGYDVVIIDHRGQGRSGRLLQDSHRGHVEAFDHYVDDLETL
YQKEIASRDYRHRYALAHSMGGAILTLMLARQPKAFDAVVLASPMFGIYLPMPVWMANQI
LNWAEKRPAFRDGYAMGTGKWRARPFGINALTHSRERYRRNLRFYADDPGLRVGGPTYHW
VREGVLAGQSILEKAKEITTPLLLLQAGADKVVDNRAQDLFCQAMTTAGQLCEGGKPFVI
DGARHEILFEKDSMRAEALDAIVAFFSRHP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtcgaaaaaacggctggccaacgcgtgaaaaggcgtttgccgcttttgctaca
ggcccgctgctggatttctggaagcgccgggaagagggtgaatttaccggcgtggaagac
gtggcgatccgctacgtccgcttcagcgctgaaaaacacgataacgttattctgctctgc
ccggggcgcatcgaaagctacgtgaaataccctgagctggcctacgatctgttccactgc
ggctatgatgtggtgattatcgaccaccgcgggcagggacgttcgggccggttgctgcag
gattcgcaccgtgggcacgtagaagccttcgaccactatgtcgacgatctggaaacgctg
tatcaaaaggaaattgccagccgcgattaccgtcatcgttatgcgcttgctcactcgatg
ggtggcgcgatcctgacgctgatgctggcaagacagccgaaagcgttcgatgcggtagtg
ctggcgtcaccaatgttcggtatctatctgccgatgcccgtatggatggccaaccagatc
ctgaactgggcagagaaacgtccggcattccgtgatggttatgcgatgggcaccggaaaa
tggcgcgcacgcccgtttggtatcaatgcgctgacccacagccgtgaacgttaccggcgc
aatctgcgcttttacgctgacgaccccggcctgcgggtaggtggtccaacctatcattgg
gtgcgtgaaggcgtgctggccggacaaagcattttagagaaagcgaaagaaatcaccacg
ccgctgctgctgctgcaggccggtgcggacaaggtggtggataaccgggcccaggattta
ttctgtcaggccatgaccactgcggggcaactctgtgaagggggaaaaccgtttgttatc
gacggcgcgcgtcatgagatcttgtttgaaaaagacagcatgcgtgccgaagcgctggac
gcgatcgtcgcgtttttttccagacatccctaa

DBGET integrated database retrieval system