KEGG   Erwinia billingiae: EbC_02820Help
Entry
EbC_02820         CDS       T01270                                 

Gene name
aceB
Definition
Malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ebi  Erwinia billingiae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EbC_02820 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EbC_02820 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    EbC_02820 (aceB)
Enzymes [BR:ebi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     EbC_02820 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
334092..335690
Genome map
AA seq 532 aa AA seqDB search
MTQQVISTDLTFQRPSGPKERQILTDTAVEFLTELVTRFTPRRNELLNARKQQQQRYDAG
ELPGFISETNSIKQSDWKIRGIPADLLNRRVEITGPVERKMVINALNANVNVFMADFEDS
LAPSWDKVIEGQINLRDAVTGTISYCNEAGKIYQLKPDPAVLVCRVRGLHLPEKHVTWRG
DAIPGSLFDFALYFFHNVDALLAKGSGPYFYLPKTQSWQEAAWWSEVFSFAEDRFDLPRG
TIKATLLIETLPAVFQMDEILFSLRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQSV
TMEKGFLDAYSRLLIRTCHRRGAFAMGGMAAFIPSKDQERNQWVLNRVKTDKEREATNGH
DGTWIAHPGLADTVTAVFDRVLGDKPNQLDVLRDDDAAITAEQLLAPCDGERTEAGMRAN
IRVAVQYIEAWISGNGCVPVYGLMEDAATAEISRTSIWQWIRHGKTLQSGEQVTEALFRQ
MLAEEMLVIQQELGDQRFSQGRFCEAAELMERITTEPELVEFLTLPGYSLLH
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaggttatcagcaccgatttgacgttccagcgcccatcaggcccgaaagag
cggcaaatcctgaccgatacggcagttgaattcctgactgaactggtgacgcgcttcacc
ccgcgtcgcaatgaattactgaatgccaggaagcagcagcagcagcgatatgatgccggt
gagttgcccggatttatttcggaaacgaattccattaagcaaagcgactggaaaattcgc
ggcattcccgctgacctgctcaatcgccgggtcgagatcaccggtccggttgaacgcaag
atggtaatcaatgccctgaatgccaacgtgaacgtttttatggctgacttcgaagactcg
ctggcaccctcgtgggacaaagtgatcgaagggcagatcaacctgcgtgatgcggttacc
ggcaccatcagttactgcaatgaagccgggaagatctaccaactgaagccggatcctgcg
gtgctggtgtgccgcgttcgcggtctgcacctgcctgagaaacatgtcacctggcgcggt
gacgctatccccggcagcctgtttgatttcgcgctctactttttccacaacgttgacgcg
ttgctggccaaaggcagcggtccctatttttacttgccaaaaacccagagttggcaggaa
gcggcctggtggagcgaggtgttcagttttgctgaggatcgtttcgatctgccacgcggc
acgatcaaggccacgctgttgatcgagacgctgccggcggtcttccagatggacgagatc
cttttcagcctgcgcgatcatatcgtcggcctgaactgcggtcgctgggactacatcttc
agctatatcaaaaccctgaaaaatcacccggaccgcgtattgcccgatcgccagtcggtg
acgatggaaaaaggcttcctcgatgcctactcgcggctgctgatcagaacctgtcaccgc
cggggcgcgtttgcgatgggcggaatggcggcctttatcccgagcaaagatcaggagcgc
aaccagtgggtgctcaaccgggtgaagaccgataaagagcgtgaggcgaccaacggccac
gacggcacctggattgctcaccccgggctggcagatacggtcacggcggtgttcgatcgg
gtgctgggcgacaaacccaatcagctggacgtgctacgggacgacgacgcagccatcacc
gcggaacagctgctggcgccctgtgacggtgaaaggaccgaggctggtatgcgcgccaac
attcgcgtggccgtgcagtacatcgaagcgtggatctccggcaatggctgcgtgccggtg
tacggattgatggaagatgccgcgacggccgaaatctcccgcacctcgatctggcagtgg
atccgccacggcaaaacgctgcaaagcggtgagcaggtgaccgaagcgctgttccgccag
atgctggccgaagagatgctggtgatccagcaagagcttggcgaccaacgcttctctcag
gggcgcttctgtgaagccgccgaactgatggaacgcatcaccactgaacctgaactggtg
gagttcctgactctgccgggctacagcttacttcactga

DBGET integrated database retrieval system