KEGG   Erwinia billingiae: EbC_02830Help
Entry
EbC_02830         CDS       T01270                                 

Gene name
aceA
Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ebi  Erwinia billingiae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ebi01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ebi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
335709..337013
Genome map
AA seq 434 aa AA seqDB search
MTSRTQQIEHLTQSWNDARWEGITRPYTAEEVVRLRGSVNPACTLAQLGAEKLWHLLNGG
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAGSMYPDQSLYPANSVPSV
VERINNTFQRADQIQWANQIEPGDARHVDYYLPIVADAEAGFGGVLNAFELMKAMIQAGA
GGVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMAVPTVLIARTDADAADL
ITSDCDDYDREFITGERTPEGFFKTHAGIEQAISRGLAYAPYADVLWCETSTPDLSLAKR
FADAIHARFPGKLLAYNCSPSFNWKKNLDDNTIAHFQQSLSEMGYRFQFITLAGIHSMWF
NMFDLARSYAEGEGMRHYVEKVQQPEFAAREQGYTFSSHQQEVGTGYFDSVTNIIQGGVS
SVTALTGSTEEQQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcgtacccaacagatcgaacacctgacgcaatcctggaacgatgcacgctgg
gaaggcattacccgtccttacacagcggaagaggtggtgaggctgcgcggctcggttaat
ccggcctgcactctggcacagctgggagcagaaaaactgtggcatctgctgaacggtggg
tcgaagaagggctatatcaacagccttggcgcgctgaccggcggccaggcactgcagcag
gcgaaagcggggatcgaggcggtgtatctctccggctggcaggtggcggcggatgccaac
ctcgccggcagcatgtatcccgatcagtcgctctacccggccaactcggtgccatcggtg
gttgaacgcattaacaacaccttccagcgagccgatcagatccagtgggccaatcagatt
gaacctggcgacgcgcgtcatgtggattattacctgccgatcgttgccgatgcagaagcg
ggctttggcggcgtgctgaatgcctttgaactgatgaaggcgatgattcaggccggggca
ggcggggtgcattttgaggatcagctggcgtcggtgaaaaaatgcggccatatgggcggc
aaggtgctggtgcccacccaggaagcgattcagaagctggttgcggcaaggctggcggct
gatgtgatggcggtgccaacggtgctgattgcccgcactgacgcggatgccgccgactta
atcacctccgactgcgatgactatgaccgcgaatttatcaccggcgagcgcacgcctgaa
ggcttctttaaaacgcatgccggtattgagcaagcgatcagtcgcgggctggcttacgcg
ccctatgccgatgtgctgtggtgcgaaacctcgacgccggatttgtcgctggcgaagcgc
tttgccgacgctattcatgcccgtttcccgggcaagctgctggcctataactgctcgcct
tcgtttaactggaagaagaacctcgatgacaacaccatcgcgcatttccagcagtcgctg
agtgaaatgggttaccgcttccagtttattaccctggcgggcatccacagcatgtggttc
aacatgttcgatcttgcccgcagctacgccgaaggggaagggatgcgccattacgtggaa
aaagtgcagcagccggagtttgccgcgcgggagcagggttacaccttctcctcccatcag
caggaagtcggaaccggttattttgacagcgtcaccaatatcatccagggcggcgtctcg
tcagtgaccgcgctgaccggatcaacggaagaacagcagttctga

DBGET integrated database retrieval system