KEGG   Erwinia billingiae: EbC_05730Help
Entry
EbC_05730         CDS       T01270                                 

Gene name
holD
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ebi  Erwinia billingiae
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EbC_05730 (holD)
   00240 Pyrimidine metabolism
    EbC_05730 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    EbC_05730 (holD)
   03430 Mismatch repair
    EbC_05730 (holD)
   03440 Homologous recombination
    EbC_05730 (holD)
Enzymes [BR:ebi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EbC_05730 (holD)
DNA replication proteins [BR:ebi03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EbC_05730 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
673760..674179
Genome map
AA seq 139 aa AA seqDB search
MSSRRDWLLQQMGITQYTLRRPRALQGEVAVSLPEQTRLLIVAEVPPLLSDPLISDVLRA
MLMREQEVVVLTPEQLAMLPDDTRCASWCLGVEPAAMPDGSQIASPVLAELYHNAGAKRA
LWQQISHYESDFFTDPARS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccagacgtgactggttattacagcaaatgggcataacgcagtatacgctgcgg
cgtccgcgtgccttacagggtgaggttgcggtgtcactgccggaacagactcgcctgctg
attgtggcggaagtgccgcctctgctctcagatccgctgattagcgatgtgctccgcgcg
atgctgatgcgcgagcaggaggtggtggtgctgaccccggaacaactggcgatgctgcca
gacgatacccgttgtgcgagctggtgtctgggtgtagaacccgccgccatgcctgacggt
tcacagatcgcttcgcctgttcttgcggagctctatcataatgccggtgccaaacgcgcg
ctgtggcagcagatctcccactatgaatcagatttctttactgaccccgcacgatcttga

DBGET integrated database retrieval system