KEGG   Erwinia billingiae: EbC_06090Help
Entry
EbC_06090         CDS       T01270                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ebi  Erwinia billingiae
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EbC_06090
Enzymes [BR:ebi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     EbC_06090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
720997..722319
Genome map
AA seq 440 aa AA seqDB search
MFLPQEIIRKKRDGQPLTEEEIRFFINGVRDNTVSEGQIAALAMTIYFHDMTLQERVALT
MAMRDSGSVLNWKALNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDETFRRIIKDVGVAIIGQTNSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTFEQSELLAQSIVGVANGAGCKTTALLT
DMNQVLASSAGNALEVREAVRFLTGEYRNPRLLEVTLALSAEMLVSGGLAANTDEATGKL
QAVLDNGKAAEIFARMVAAQKGPTDFIEQMDKYLPAPMLSKAVYADKPGIVSAMDTRALG
MAVVSMGGGRRQASDPLDYSVGFSEMAQLGDRADNQRPLAVIHAATETAWQEAAEAMKRA
VTLSENAPAQTPVIYRRISG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgttcctgccacaagaaattatccgtaaaaaaagagatggccagccgctgacggaagaa
gagatccgcttctttattaatggcgtgcgtgataacaccgtgtctgaagggcaaatcgcc
gcgctggcgatgaccatttatttccacgatatgacgctgcaggagcgggtcgcgctgacc
atggcgatgcgcgactccggctcggtactcaactggaaggcgctgaatcttaacggcccg
atcgtggacaagcactcaaccggcggcgtgggcgatgtaacctcgctgatgctcggtccg
atggtggcggcatgcggtggctatgtgccgatgatttctggccgtggcctcggccacacg
ggcgggacgctggacaagctggaagccattccgggctttgatatcttccctgatgacgag
acgttccgtcgcatcatcaaagacgtcggcgtggcgattatcggccagaccaactcgctg
gcgcctgcggataagcgtttctacgccacccgcgacatcaccgcgaccgtcgattcgatt
ccgctgatcactgcctcgatcctcgccaaaaaactggcggaaggtctggatgcgctggtg
atggacgttaaagtcggctccggggcctttatgccgaccttcgaacagtccgagctgctg
gcccagtcgattgttggcgtggcgaacggcgcgggctgtaaaaccaccgcgctgttaacc
gatatgaatcaggtgctggcgtcaagtgccggtaatgcgctggaagtgcgtgaagccgtg
cgcttcctgaccggcgaataccgcaatccacgcctgctggaagtgacgctggctttgagt
gcggaaatgctggtgtccggtgggcttgcggccaataccgacgaagccaccggcaaactg
caggcggtgctggataacggcaaggcagcagaaatctttgcgcgcatggtcgcggcgcaa
aaaggcccgacagactttatcgagcagatggataaatatttaccggcgccgatgctcagc
aaggcggtgtatgccgacaagccgggcatcgtcagcgcaatggatactcgtgcgctcggc
atggcggtggtgtcgatgggcggcggtcgtcgtcaggccagcgatccgctcgattacagc
gtcggattcagtgagatggcgcaactgggtgaccgtgcagacaaccagcgtccgctggcg
gtgatccacgccgctacggaaaccgcctggcaggaagccgctgaggcgatgaagcgcgcg
gtgaccttaagcgaaaatgcgccggcccagaccccagttatctatcgcagaattagcgga
taa

DBGET integrated database retrieval system