KEGG   Erwinia billingiae: EbC_06230Help
Entry
EbC_06230         CDS       T01270                                 

Definition
sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ebi  Erwinia billingiae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EbC_06230
Enzymes [BR:ebi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EbC_06230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
737005..737919
Genome map
AA seq 304 aa AA seqDB search
MDIAVIGSNMVDLITYTNSMPKAGETLEAPDFALGCGGKGANQAVAAAKLGASVMMVSKV
GEDLFADNTVKNLQRFGVDAQHVTVAAGTSSGVAPIFVDDQSQNRILIIKGANAHLSPAD
IDAAAEDLKRCRLMVLQLEIPLPTVYYAIDFARQNGIQVILNPAPAVAGLDIDYACQCDF
FMPNETELEILTGLPVSTEDEVLRAGQMLLGRGLKNLIITLGSRGSVWMQGDAVHRIKPT
PVKAIDTSGAGDAFIGCFAHFLIQHGDIAKAMQSASDYAACSVTGRGTQLSYPDADTFHR
FLND
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggacattgccgtcatcggctccaatatggtcgatctgatcacctacaccaacagcatg
ccgaaagccggtgaaaccttagaagcgccagacttcgcactgggctgcggcggcaaaggg
gccaaccaggccgttgcggcggcgaagctgggtgccagcgtgatgatggtcagcaaagtg
ggcgaagacctgtttgcggacaacacggtgaaaaacttgcagcggttcggcgtcgacgcg
cagcacgtcaccgtcgcggcgggcacctccagcggcgtggcaccgatttttgtcgatgac
cagtcgcaaaaccgcatcctgattatcaaaggggccaacgcgcacctgtctccggcggat
attgatgccgcggcggaggatcttaagcgctgccgtctgatggtgttgcagctggagatc
ccgctgccgacggtctattacgccatcgactttgcgcggcagaacggcattcaggtgatc
ctcaatcccgcgccggcggtggccggtttggacatcgattacgcctgccagtgcgacttc
tttatgccgaacgaaaccgaactggagatcctgacgggcctgccggtcagcaccgaagac
gaagtgctgcgcgccgggcagatgctgctgggacgcggcctgaaaaacctgattatcact
ctcggcagccgcggatcggtgtggatgcagggagatgccgtccaccgcattaagcccacg
ccggtgaaggcgattgataccagtggcgcaggggatgcctttatcggctgctttgcccac
tttctgatccagcatggcgatatcgcgaaggcaatgcagtctgcctccgactatgccgcc
tgtagcgtcaccggacggggaacccagctttcgtaccctgatgccgataccttccaccgt
tttctcaacgattaa

DBGET integrated database retrieval system