KEGG   Erwinia billingiae: EbC_06620Help
Entry
EbC_06620         CDS       T01270                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ebi  Erwinia billingiae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EbC_06620 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EbC_06620 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EbC_06620 (thrC)
Enzymes [BR:ebi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EbC_06620 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
794576..795862
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFSQAVKQGLGKQQGLFFPLELPEFELTDIDEMLEMDFVTRSSKILS
AFIGDEIEPHQLHQRLKTAFSFPAPVQKVTDDIAALELFHGPTLAFKDFGGRFMAQMLSY
VSGADEKITILTATSGDTGAAVAHAFFGMENVRVVILYPKGKISPLQEKLFCTLGGNIQT
IAIEGDFDACQSLVKQAFDDELLKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLEKGEWQPNATVSTLSN
AMDVSQPNNWPRVEEIFRRKTWRLTDLGFGAVDDQTTKDTMRELADLGYISEPHAAIAYR
MLRDQLQEGEFGLFLGTAHPAKFIESVEAILDRKLPVPEELAQRANLPLLSHEMKADFAE
LREFLLHK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataatcttaaggatcacaacgagcaggtaagcttctcgcaggccgttaag
caaggcctcggcaaacagcagggcctgttctttccgcttgagctgcctgagtttgaactg
accgacatcgacgagatgttggaaatggatttcgttacccgcagtagcaaaatcctctct
gcctttattggcgatgagatcgaacctcatcagctgcatcagcgcctgaaaaccgccttc
agcttcccggcaccggtacaaaaggtgacggatgatatcgctgcgctggagctgttccat
ggtccaacgctggcgtttaaagactttggcggccgttttatggcgcaaatgctctcctac
gttagcggcgccgatgagaaaatcaccattctgaccgccacttccggcgataccggtgcg
gcagttgctcatgctttcttcggcatggaaaacgttcgcgtggtgatcctctatccgaaa
ggtaaaatcagtccgctgcaggaaaaactgttctgtacgctgggtggcaatatccagacc
atcgccattgaaggcgatttcgatgcctgtcagtcactggtgaagcaggcctttgatgat
gagctgctgaagaaagccattggcctgaactcggcaaactcaatcaacatcagccgcctg
ctggcgcagatttgttactacttcgaagcggtggcacaactgcctcaggagaagcgtaac
cagctggtgatctccgtaccgagtggtaacttcggcgacctgaccgcgggcctgctggcg
aaatcccttggcctgccggttaagcgctttattgccgctaccaacgccaatgacaccgtt
ccgcgcttccttgagaagggcgaatggcagcctaatgccacggtttccaccttgtctaac
gcgatggatgtcagccagccgaacaactggccgcgcgtggaagagatcttccgccgcaaa
acctggcgcctgaccgatctgggctttggtgcggttgatgatcagaccaccaaagacacc
atgcgtgagctggcggacctgggttacatctctgagccccacgcggcgattgcttaccgt
atgctgcgcgatcagttgcaggaaggggaatttggtttgttcctcggcaccgcgcacccg
gccaagtttatcgaaagcgtggaagcgatcctcgaccgcaagctgccggtgccagaagag
ctggcacagcgtgccaacctgccgctgctctcccatgagatgaaagcggacttcgccgaa
ctgcgcgagttcctgttgcacaaataa

DBGET integrated database retrieval system