KEGG   Erwinia billingiae: EbC_06620Help
Entry
EbC_06620         CDS       T01270                                 

Gene name
thrC
Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ebi  Erwinia billingiae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ebi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ebi00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ebi00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
794576..795862
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFSQAVKQGLGKQQGLFFPLELPEFELTDIDEMLEMDFVTRSSKILS
AFIGDEIEPHQLHQRLKTAFSFPAPVQKVTDDIAALELFHGPTLAFKDFGGRFMAQMLSY
VSGADEKITILTATSGDTGAAVAHAFFGMENVRVVILYPKGKISPLQEKLFCTLGGNIQT
IAIEGDFDACQSLVKQAFDDELLKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLEKGEWQPNATVSTLSN
AMDVSQPNNWPRVEEIFRRKTWRLTDLGFGAVDDQTTKDTMRELADLGYISEPHAAIAYR
MLRDQLQEGEFGLFLGTAHPAKFIESVEAILDRKLPVPEELAQRANLPLLSHEMKADFAE
LREFLLHK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataatcttaaggatcacaacgagcaggtaagcttctcgcaggccgttaag
caaggcctcggcaaacagcagggcctgttctttccgcttgagctgcctgagtttgaactg
accgacatcgacgagatgttggaaatggatttcgttacccgcagtagcaaaatcctctct
gcctttattggcgatgagatcgaacctcatcagctgcatcagcgcctgaaaaccgccttc
agcttcccggcaccggtacaaaaggtgacggatgatatcgctgcgctggagctgttccat
ggtccaacgctggcgtttaaagactttggcggccgttttatggcgcaaatgctctcctac
gttagcggcgccgatgagaaaatcaccattctgaccgccacttccggcgataccggtgcg
gcagttgctcatgctttcttcggcatggaaaacgttcgcgtggtgatcctctatccgaaa
ggtaaaatcagtccgctgcaggaaaaactgttctgtacgctgggtggcaatatccagacc
atcgccattgaaggcgatttcgatgcctgtcagtcactggtgaagcaggcctttgatgat
gagctgctgaagaaagccattggcctgaactcggcaaactcaatcaacatcagccgcctg
ctggcgcagatttgttactacttcgaagcggtggcacaactgcctcaggagaagcgtaac
cagctggtgatctccgtaccgagtggtaacttcggcgacctgaccgcgggcctgctggcg
aaatcccttggcctgccggttaagcgctttattgccgctaccaacgccaatgacaccgtt
ccgcgcttccttgagaagggcgaatggcagcctaatgccacggtttccaccttgtctaac
gcgatggatgtcagccagccgaacaactggccgcgcgtggaagagatcttccgccgcaaa
acctggcgcctgaccgatctgggctttggtgcggttgatgatcagaccaccaaagacacc
atgcgtgagctggcggacctgggttacatctctgagccccacgcggcgattgcttaccgt
atgctgcgcgatcagttgcaggaaggggaatttggtttgttcctcggcaccgcgcacccg
gccaagtttatcgaaagcgtggaagcgatcctcgaccgcaagctgccggtgccagaagag
ctggcacagcgtgccaacctgccgctgctctcccatgagatgaaagcggacttcgccgaa
ctgcgcgagttcctgttgcacaaataa

DBGET integrated database retrieval system