KEGG   Erwinia billingiae: EbC_06620Help
Entry
EbC_06620         CDS       T01270                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ebi  Erwinia billingiae
Pathway
ebi00260  Glycine, serine and threonine metabolism
ebi00750  Vitamin B6 metabolism
ebi01100  Metabolic pathways
ebi01110  Biosynthesis of secondary metabolites
ebi01120  Microbial metabolism in diverse environments
ebi01230  Biosynthesis of amino acids
Module
ebi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EbC_06620 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EbC_06620 (thrC)
Enzymes [BR:ebi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EbC_06620 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CAX58193
UniProt: D8MMY6
Position
794576..795862
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFSQAVKQGLGKQQGLFFPLELPEFELTDIDEMLEMDFVTRSSKILS
AFIGDEIEPHQLHQRLKTAFSFPAPVQKVTDDIAALELFHGPTLAFKDFGGRFMAQMLSY
VSGADEKITILTATSGDTGAAVAHAFFGMENVRVVILYPKGKISPLQEKLFCTLGGNIQT
IAIEGDFDACQSLVKQAFDDELLKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLEKGEWQPNATVSTLSN
AMDVSQPNNWPRVEEIFRRKTWRLTDLGFGAVDDQTTKDTMRELADLGYISEPHAAIAYR
MLRDQLQEGEFGLFLGTAHPAKFIESVEAILDRKLPVPEELAQRANLPLLSHEMKADFAE
LREFLLHK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataatcttaaggatcacaacgagcaggtaagcttctcgcaggccgttaag
caaggcctcggcaaacagcagggcctgttctttccgcttgagctgcctgagtttgaactg
accgacatcgacgagatgttggaaatggatttcgttacccgcagtagcaaaatcctctct
gcctttattggcgatgagatcgaacctcatcagctgcatcagcgcctgaaaaccgccttc
agcttcccggcaccggtacaaaaggtgacggatgatatcgctgcgctggagctgttccat
ggtccaacgctggcgtttaaagactttggcggccgttttatggcgcaaatgctctcctac
gttagcggcgccgatgagaaaatcaccattctgaccgccacttccggcgataccggtgcg
gcagttgctcatgctttcttcggcatggaaaacgttcgcgtggtgatcctctatccgaaa
ggtaaaatcagtccgctgcaggaaaaactgttctgtacgctgggtggcaatatccagacc
atcgccattgaaggcgatttcgatgcctgtcagtcactggtgaagcaggcctttgatgat
gagctgctgaagaaagccattggcctgaactcggcaaactcaatcaacatcagccgcctg
ctggcgcagatttgttactacttcgaagcggtggcacaactgcctcaggagaagcgtaac
cagctggtgatctccgtaccgagtggtaacttcggcgacctgaccgcgggcctgctggcg
aaatcccttggcctgccggttaagcgctttattgccgctaccaacgccaatgacaccgtt
ccgcgcttccttgagaagggcgaatggcagcctaatgccacggtttccaccttgtctaac
gcgatggatgtcagccagccgaacaactggccgcgcgtggaagagatcttccgccgcaaa
acctggcgcctgaccgatctgggctttggtgcggttgatgatcagaccaccaaagacacc
atgcgtgagctggcggacctgggttacatctctgagccccacgcggcgattgcttaccgt
atgctgcgcgatcagttgcaggaaggggaatttggtttgttcctcggcaccgcgcacccg
gccaagtttatcgaaagcgtggaagcgatcctcgaccgcaagctgccggtgccagaagag
ctggcacagcgtgccaacctgccgctgctctcccatgagatgaaagcggacttcgccgaa
ctgcgcgagttcctgttgcacaaataa

DBGET integrated database retrieval system